Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - manually
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - manually
NMR Structure - manually  (Jmol Viewer)
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  SOLUTION STRUCTURE OF THE PLUS-3 DOMAIN OF HUMAN KIAA0252 PROTEIN
 
Authors :  M. Yoneyama, T. Kigawa, N. Tochio, N. Nameki, S. Koshiba, M. Inoue, S. Yokoyama, Riken Structural Genomics/Proteomics Initiative (Rsgi)
Date :  15 Dec 05  (Deposition) - 15 Jun 06  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (20x)
Keywords :  Plus-3 Domain; Structural Genomics, Kiaa0252, Nppsfa, National Project On Protein Structural And Functional Analyses, Riken Structural Genomics/Proteomics Initiative, Rsgi, Structural Genomics, Unknown Function (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  M. Yoneyama, T. Kigawa, N. Tochio, N. Nameki, S. Koshiba, M. Inoue, S. Yokoyama
Solution Structure Of The Plus-3 Domain Of Human Kiaa0252 Protein
To Be Published
PubMed: search
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - PAF1/RNA POLYMERASE II COMPLEX COMPONENT
    Chains: A
    Engineered: YES
    Expression System: CELL FREE SYNTHESIS
    Expression System Plasmid: P050302-16
    Expression System Vector Type: PLASMID
    Fragment: PLUS-3 DOMAIN, RESIDUES 8-143
    Gene: RTF1
    Organism Common: HUMAN
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606
    Other Details: CELL-FREE PROTEIN SYNTHESIS
    Synonym: KIAA0252 PROTEIN

 Structural Features

(-) Chains, Units

  
NMR Structure (20x): 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2DB9)

(-) Sites  (0, 0)

(no "Site" information available for 2DB9)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2DB9)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2DB9)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2DB9)

(-) PROSITE Motifs  (1, 1)

NMR Structure (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PLUS3PS51360 Plus3 domain profile.RTF1_HUMAN353-484  1A:14-143

(-) Exons   (6, 6)

NMR Structure (6, 6)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1aENST000003896291aENSE00002188164chr15:41709302-41709511210RTF1_HUMAN1-66660--
1.2ENST000003896292ENSE00001685099chr15:41730519-41730629111RTF1_HUMAN67-103370--
1.4bENST000003896294bENSE00001644351chr15:41745099-41745246148RTF1_HUMAN104-153500--
1.5ENST000003896295ENSE00000931009chr15:41749870-41750074205RTF1_HUMAN153-221690--
1.6ENST000003896296ENSE00001029847chr15:41756969-41757083115RTF1_HUMAN221-259390--
1.7ENST000003896297ENSE00000931011chr15:41758339-41758450112RTF1_HUMAN260-297380--
1.8ENST000003896298ENSE00000931012chr15:41762455-41762590136RTF1_HUMAN297-342461A:1-77
1.9ENST000003896299ENSE00000931013chr15:41763370-41763547178RTF1_HUMAN342-401601A:8-6255
1.10bENST0000038962910bENSE00000931014chr15:41766818-4176690083RTF1_HUMAN402-429281A:63-9028
1.11ENST0000038962911ENSE00001152999chr15:41767723-4176781088RTF1_HUMAN429-458301A:90-11930
1.12ENST0000038962912ENSE00001152995chr15:41767910-41768017108RTF1_HUMAN459-494361A:120-14425
1.13ENST0000038962913ENSE00001152991chr15:41768644-4176872178RTF1_HUMAN495-520261A:145-1495
1.14bENST0000038962914bENSE00001152986chr15:41769363-41769484122RTF1_HUMAN521-561410--
1.15ENST0000038962915ENSE00001152980chr15:41769656-4176971358RTF1_HUMAN561-580200--
1.16ENST0000038962916ENSE00000931020chr15:41770746-4177082378RTF1_HUMAN581-606260--
1.17ENST0000038962917ENSE00001506418chr15:41771301-4177139696RTF1_HUMAN607-638320--
1.18ENST0000038962918ENSE00000931022chr15:41772412-41772523112RTF1_HUMAN639-676380--
1.19bENST0000038962919bENSE00001944328chr15:41772779-417757612983RTF1_HUMAN676-710350--

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:149
 aligned with RTF1_HUMAN | Q92541 from UniProtKB/Swiss-Prot  Length:710

    Alignment length:181
                                   339       349       359       369       379       389       399       409       419       429       439       449       459       469       479       489       499       509 
           RTF1_HUMAN   330 RSSRTSSSDEEEEKEEIPPKSQPVSLPEELNRVRLSRHKLERWCHMPFFAKTVTGCFVRIGIGNHNSKPVYRVAEITGVVETAKVYQLGGTRTNKGLQLRHGNDQRVFRLEFVSNQEFTESEFMKWKEAMFSAGMQLPTLDEINKKELSIKEALNYKFNDQDIEEIVKEKERFRKAPPNYA 510
               SCOP domains -----------------d2db9a1 A:8-143 RNA polymerase-associated protein RTF1 homolog                                                                          ---------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......----------........hhhhhhhh..hhhhhhhhh...hhhhhhh..eeeeeee......eeeeee..eeeeeeeeeee..eeeeeeee.ee..ee.............hhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhh----------------------..... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -----------------------PLUS3  PDB: A:14-143 UniProt: 353-484                                                                                               -------------------------- PROSITE
           Transcript 1 (1) Exon 1.8     -----------------------------------------------------------Exon 1.10b  PDB: A:63-90    -----------------------------Exon 1.12  PDB: A:120-144           Exon 1.13        Transcript 1 (1)
           Transcript 1 (2) ------------Exon 1.9  PDB: A:8-62 UniProt: 342-401 [INCOMPLETE]         ---------------------------Exon 1.11  PDB: A:90-119      ---------------------------------------------------- Transcript 1 (2)
                 2db9 A   1 GSSGSSG----------PPKSQPVSLPEELNRVRLSRHKLERWCHMPFFAKTVTGCFVRIGIGNHNSKPVYRVAEITGVVETAKVYQLGGTRTNKGLQLRHGNDQRVFRLEFVSNQEFTESEFMKWKEAMFSAGMQLPTLDEINKKELSIKEAS----------------------GPSSG 149
                                  |  -       |10        20        30        40        50        60        70        80        90       100       110       120       130       140   |     -         -      |148 
                                  7          8                                                                                                                                     144                    145    

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2DB9)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2DB9)

(-) Gene Ontology  (20, 20)

NMR Structure(hide GO term definitions)
Chain A   (RTF1_HUMAN | Q92541)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0003697    single-stranded DNA binding    Interacting selectively and non-covalently with single-stranded DNA.
biological process
    GO:0016055    Wnt signaling pathway    The series of molecular signals initiated by binding of a Wnt protein to a frizzled family receptor on the surface of the target cell and ending with a change in cell state.
    GO:0001832    blastocyst growth    An increase in size of a blastocyst due to expansion of the blastocoelic cavity cell shape changes and cell proliferation.
    GO:0001711    endodermal cell fate commitment    The cell differentiation process that results in commitment of a cell to become part of the endoderm.
    GO:0080182    histone H3-K4 trimethylation    The modification of histone H3 by addition of three methyl groups to lysine at position 4 of the histone.
    GO:0016570    histone modification    The covalent alteration of one or more amino acid residues within a histone protein.
    GO:0000122    negative regulation of transcription from RNA polymerase II promoter    Any process that stops, prevents, or reduces the frequency, rate or extent of transcription from an RNA polymerase II promoter.
    GO:0051571    positive regulation of histone H3-K4 methylation    Any process that activates or increases the frequency, rate or extent of the covalent addition of a methyl group to the lysine at position 4 of histone H3.
    GO:0032968    positive regulation of transcription elongation from RNA polymerase II promoter    Any process that activates or increases the frequency, rate or extent of transcription elongation, the extension of an RNA molecule after transcription initiation and promoter clearance by the addition of ribonucleotides, catalyzed by RNA polymerase II.
    GO:0045944    positive regulation of transcription from RNA polymerase II promoter    Any process that activates or increases the frequency, rate or extent of transcription from an RNA polymerase II promoter.
    GO:0006355    regulation of transcription, DNA-templated    Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0019827    stem cell population maintenance    The process by which an organism or tissue maintains a population of stem cells of a single type. This can be achieved by a number of mechanisms: stem cell asymmetric division maintains stem cell numbers; stem cell symmetric division increases them; maintenance of a stem cell niche maintains the conditions for commitment to the stem cell fate for some types of stem cell; stem cells may arise de novo from other cell types.
    GO:0006368    transcription elongation from RNA polymerase II promoter    The extension of an RNA molecule after transcription initiation and promoter clearance at an RNA polymerase II promoter by the addition of ribonucleotides catalyzed by RNA polymerase II.
    GO:0006351    transcription, DNA-templated    The cellular synthesis of RNA on a template of DNA.
cellular component
    GO:0016593    Cdc73/Paf1 complex    A multiprotein complex that associates with RNA polymerase II and general RNA polymerase II transcription factor complexes and may be involved in both transcriptional initiation and elongation. In Saccharomyces the complex contains Paf1p, Cdc73p, Ctr9p, Rtf1p, and Leo1p.
    GO:0005730    nucleolus    A small, dense body one or more of which are present in the nucleus of eukaryotic cells. It is rich in RNA and protein, is not bounded by a limiting membrane, and is not seen during mitosis. Its prime function is the transcription of the nucleolar DNA into 45S ribosomal-precursor RNA, the processing of this RNA into 5.8S, 18S, and 28S components of ribosomal RNA, and the association of these components with 5S RNA and proteins synthesized outside the nucleolus. This association results in the formation of ribonucleoprotein precursors; these pass into the cytoplasm and mature into the 40S and 60S subunits of the ribosome.
    GO:0005654    nucleoplasm    That part of the nuclear content other than the chromosomes or the nucleolus.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2db9)
 
  Sites
(no "Sites" information available for 2db9)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2db9)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2db9
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  RTF1_HUMAN | Q92541
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  RTF1_HUMAN | Q92541
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        RTF1_HUMAN | Q92541: 2bze 3u1u 4l1p 4l1u

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2DB9)