2CVD - JenaLib

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Title :   CRYSTAL STRUCTURE ANALYSIS OF HUMAN HEMATOPOIETIC PROSTAGLANDIN D SYNTHASE COMPLEXED WITH HQL-79

Authors :   K. Aritake, Y. Kado, T. Inoue, M. Miyano, Y. Urade

Date :   02 Jun 05 (Deposition) - 18 Apr 06 (Release) - 13 Jul 11 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.45

Chains :   Asym. Unit : A,B,C,D
Biol. Unit 1: A,D  (1x)
Biol. Unit 2: B,C  (1x)

Keywords :   Glutathione-S-Transferase, Isomerase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   K. Aritake, Y. Kado, T. Inoue, M. Miyano, Y. Urade
Structural And Functional Characterization Of Hql-79, An Orally Selective Inhibitor Of Human Hematopoietic Prostaglandin D Synthase.
J. Biol. Chem. V. 281 15277 2006
PubMed-ID: 16547010 | Reference-DOI: 10.1074/JBC.M506431200

Molecule 1 - GLUTATHIONE-REQUIRING PROSTAGLANDIN D SYNTHASE
	Chains	:	A, B, C, D
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PT7-7
	Expression System Taxid	:	562
	Expression System Vector Type	:	PLASMID
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	GLUTATHIONE-DEPENDENT PGD SYNTHETASE, PROSTAGLANDIN-H2 D- ISOMERASE, HEMATOPOIETIC PROSTAGLANDIN D SYNTHASE, H-PGDS

		1	2	3	4
Asymmetric Unit	:	A	B	C	D
Biological Unit 1 (1x)	:	A			D
Biological Unit 2 (1x)	:		B	C

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (4, 17)

No.	Name	Count	Type	Full Name
1	GOL	7	Ligand/Ion	GLYCEROL
2	GSH	4	Ligand/Ion	GLUTATHIONE
3	HQL	4	Ligand/Ion	4-(BENZHYDRYLOXY)-1-[3-(1H-TETRAAZOL-5-YL)PROPYL]PIPERIDINE
4	MG	2	Ligand/Ion	MAGNESIUM ION

Biological Unit 1 (3, 5)

No.	Name	Count	Type	Full Name
1	GOL	1	Ligand/Ion	GLYCEROL
2	GSH	2	Ligand/Ion	GLUTATHIONE
3	HQL	2	Ligand/Ion	4-(BENZHYDRYLOXY)-1-[3-(1H-TETRAAZOL-5-YL)PROPYL]PIPERIDINE
4	MG	-1	Ligand/Ion	MAGNESIUM ION

Biological Unit 2 (3, 10)

No.	Name	Count	Type	Full Name
1	GOL	6	Ligand/Ion	GLYCEROL
2	GSH	2	Ligand/Ion	GLUTATHIONE
3	HQL	2	Ligand/Ion	4-(BENZHYDRYLOXY)-1-[3-(1H-TETRAAZOL-5-YL)PROPYL]PIPERIDINE
4	MG	-1	Ligand/Ion	MAGNESIUM ION

Asymmetric Unit (17, 17)

No.	Name	Evidence	Residues	Description
01	AC1	SOFTWARE	HOH A:4142 , HOH A:4143 , HOH A:4144 , HOH D:2989 , HOH D:2990 , HOH D:2991	BINDING SITE FOR RESIDUE MG A 4001
02	AC2	SOFTWARE	HOH B:4126 , HOH B:4127 , HOH B:4183 , HOH C:3179 , HOH C:3180 , HOH C:3181	BINDING SITE FOR RESIDUE MG B 4002
03	AC3	SOFTWARE	TYR A:8 , ARG A:14 , TRP A:39 , LYS A:43 , LYS A:50 , ILE A:51 , GLN A:63 , SER A:64 , HQL A:2201 , HOH A:4003 , HOH A:4009 , HOH A:4045 , HOH A:4048 , HOH A:4130 , ASP D:97	BINDING SITE FOR RESIDUE GSH A 2001
04	AC4	SOFTWARE	TYR B:8 , ARG B:14 , TRP B:39 , LYS B:43 , LYS B:50 , ILE B:51 , GLN B:63 , SER B:64 , HOH B:4012 , HOH B:4016 , HOH B:4031 , HOH B:4069 , HOH B:4097 , HOH B:4103 , ASP C:97	BINDING SITE FOR RESIDUE GSH B 2002
05	AC5	SOFTWARE	ASP B:97 , TYR C:8 , ARG C:14 , TRP C:39 , LYS C:43 , LYS C:50 , ILE C:51 , GLN C:63 , SER C:64 , HOH C:3005 , HOH C:3020 , HOH C:3088 , HOH C:3153 , HOH C:3263 , HOH C:3318	BINDING SITE FOR RESIDUE GSH C 2003
06	AC6	SOFTWARE	ASP A:97 , TYR D:8 , ARG D:14 , TRP D:39 , LYS D:43 , LYS D:50 , ILE D:51 , GLN D:63 , SER D:64 , HOH D:2804 , HOH D:2821 , HOH D:2868 , HOH D:2948 , HOH D:2957	BINDING SITE FOR RESIDUE GSH D 2004
07	AC7	SOFTWARE	TYR A:8 , MET A:11 , GLY A:13 , MET A:99 , PHE A:102 , TRP A:104 , TYR A:152 , THR A:159 , GSH A:2001 , HOH A:4246	BINDING SITE FOR RESIDUE HQL A 2201
08	AC8	SOFTWARE	HOH A:4327 , TYR B:8 , MET B:11 , GLY B:13 , MET B:99 , PHE B:102 , TRP B:104 , TYR B:152 , THR B:159 , LEU B:199 , HOH B:4217	BINDING SITE FOR RESIDUE HQL B 2401
09	AC9	SOFTWARE	TYR C:8 , MET C:11 , GLY C:13 , ARG C:14 , MET C:99 , PHE C:102 , TRP C:104 , TYR C:152 , THR C:159 , HOH C:3238 , HOH C:3317	BINDING SITE FOR RESIDUE HQL C 2601
10	BC1	SOFTWARE	MET D:11 , GLY D:13 , ARG D:14 , MET D:99 , PHE D:102 , TRP D:104 , TYR D:152 , THR D:159 , HOH D:3095	BINDING SITE FOR RESIDUE HQL D 2801
11	BC2	SOFTWARE	GLN C:28 , TYR C:29 , GOL C:3002 , HOH C:3084 , HOH C:3188 , HOH C:3280 , ARG D:12 , THR D:197 , HOH D:2824 , HOH D:2827 , HOH D:2918	BINDING SITE FOR RESIDUE GOL C 3001
12	BC3	SOFTWARE	GLN C:28 , TYR C:29 , TRP C:190 , GOL C:3001 , HOH C:3041 , HOH C:3174 , LYS D:198	BINDING SITE FOR RESIDUE GOL C 3002
13	BC4	SOFTWARE	ARG C:12 , THR C:197 , GOL C:3004 , HOH C:3033 , HOH C:3043 , HOH C:3070 , GLN D:28 , TYR D:29 , HOH D:3053	BINDING SITE FOR RESIDUE GOL C 3003
14	BC5	SOFTWARE	LYS C:198 , GOL C:3003 , HOH C:3234 , GLN D:28 , TYR D:29 , HOH D:2839 , HOH D:3000	BINDING SITE FOR RESIDUE GOL C 3004
15	BC6	SOFTWARE	GLN B:28 , TYR B:29 , TRP B:190 , ARG B:193 , HOH B:4067 , HOH B:4078 , HOH B:4187	BINDING SITE FOR RESIDUE GOL B 3005
16	BC7	SOFTWARE	GLU A:84 , HIS A:87 , ILE A:142 , GLY A:143 , HOH A:4075 , TYR D:122	BINDING SITE FOR RESIDUE GOL A 3006
17	BC8	SOFTWARE	ASP B:130 , HOH B:4100 , LYS C:43 , SER C:44 , LEU C:46 , HOH C:3271 , HOH C:3272 , HOH C:3347	BINDING SITE FOR RESIDUE GOL B 3007

(no "SS Bond" information available for 2CVD)

Asymmetric Unit

No.	Residues
1	Ile A:51	-	Pro A:52
2	Ile B:51	-	Pro B:52
3	Ile C:51	-	Pro C:52
4	Ile D:51	-	Pro D:52

(no "SAP(SNP)/Variant" information available for 2CVD)

Asymmetric Unit (2, 8)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	GST_NTER	PS50404	Soluble glutathione S-transferase N-terminal domain profile.	HPGDS_HUMAN	2-79	4	A:2-79 B:2-79 C:2-79 D:2-79
2	GST_CTER	PS50405	Soluble glutathione S-transferase C-terminal domain profile.	HPGDS_HUMAN	81-199	4	A:81-199 B:81-199 C:81-199 D:81-199

Biological Unit 1 (2, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	GST_NTER	PS50404	Soluble glutathione S-transferase N-terminal domain profile.	HPGDS_HUMAN	2-79	2	A:2-79 - - D:2-79
2	GST_CTER	PS50405	Soluble glutathione S-transferase C-terminal domain profile.	HPGDS_HUMAN	81-199	2	A:81-199 - - D:81-199

Biological Unit 2 (2, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	GST_NTER	PS50404	Soluble glutathione S-transferase N-terminal domain profile.	HPGDS_HUMAN	2-79	2	- B:2-79 C:2-79 -
2	GST_CTER	PS50405	Soluble glutathione S-transferase C-terminal domain profile.	HPGDS_HUMAN	81-199	2	- B:81-199 C:81-199 -

Asymmetric Unit (5, 20)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1a	ENST00000295256	1a	ENSE00001428701	chr4:95264027-95263946	82	HPGDS_HUMAN	-	0	0	-	-
1.2a	ENST00000295256	2a	ENSE00002147371	chr4:95255789-95255648	142	HPGDS_HUMAN	1-45	45	4	A:2-45 B:2-45 C:2-45 D:2-45	44 44 44 44
1.3	ENST00000295256	3	ENSE00001238639	chr4:95239116-95239024	93	HPGDS_HUMAN	45-76	32	4	A:45-76 B:45-76 C:45-76 D:45-76	32 32 32 32
1.4	ENST00000295256	4	ENSE00001071670	chr4:95229894-95229785	110	HPGDS_HUMAN	76-112	37	4	A:76-112 B:76-112 C:76-112 D:76-112	37 37 37 37
1.6	ENST00000295256	6	ENSE00001071668	chr4:95223395-95223297	99	HPGDS_HUMAN	113-145	33	4	A:113-145 B:113-145 C:113-145 D:113-145	33 33 33 33
1.7	ENST00000295256	7	ENSE00001302624	chr4:95220795-95219686	1110	HPGDS_HUMAN	146-199	54	4	A:146-199 B:146-199 C:146-199 D:146-199	54 54 54 54

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:198
 aligned with HPGDS_HUMAN | O60760 from UniProtKB/Swiss-Prot  Length:199

    Alignment length:198
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191        
          HPGDS_HUMAN     2 PNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL 199
               SCOP domains d2cvda2 A:2-75 Class sigma GST                                            d2cvda1 A:76-199 Class sigma GST                                                                                             SCOP domains
               CATH domains 2cvdA01 A:2-75,A:184-199 Glutaredoxin                                     2cvdA02 A:76-183  [code=1.20.1050.10, no name defined]                                                      2cvdA01          CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..eeeeee..hhhhhhhhhhhhhh....eeeeehhhhhhhhhh........eeee..eeeehhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhhh..........hhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE GST_NTER  PDB: A:2-79 UniProt: 2-79                                           -GST_CTER  PDB: A:81-199 UniProt: 81-199                                                                                 PROSITE
           Transcript 1 (1) Exon 1.2a  PDB: A:2-45 UniProt: 1-45        ------------------------------Exon 1.4  PDB: A:76-112              Exon 1.6  PDB: A:113-145         Exon 1.7  PDB: A:146-199 UniProt: 146-199              Transcript 1 (1)
           Transcript 1 (2) -------------------------------------------Exon 1.3  PDB: A:45-76          --------------------------------------------------------------------------------------------------------------------------- Transcript 1 (2)
                 2cvd A   2 PNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGMSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL 199
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191

Chain B from PDB  Type:PROTEIN  Length:198
 aligned with HPGDS_HUMAN | O60760 from UniProtKB/Swiss-Prot  Length:199

    Alignment length:198
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191        
          HPGDS_HUMAN     2 PNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL 199
               SCOP domains d2cvdb2 B:2-75 Class sigma GST                                            d2cvdb1 B:76-199 Class sigma GST                                                                                             SCOP domains
               CATH domains 2cvdB01 B:2-75,B:184-199 Glutaredoxin                                     2cvdB02 B:76-183  [code=1.20.1050.10, no name defined]                                                      2cvdB01          CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..eeeeee.....hhhhhhhhhhh....eeeee...hhhhhhh........eeee..eeeehhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhh..........hhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE GST_NTER  PDB: B:2-79 UniProt: 2-79                                           -GST_CTER  PDB: B:81-199 UniProt: 81-199                                                                                 PROSITE
           Transcript 1 (1) Exon 1.2a  PDB: B:2-45 UniProt: 1-45        ------------------------------Exon 1.4  PDB: B:76-112              Exon 1.6  PDB: B:113-145         Exon 1.7  PDB: B:146-199 UniProt: 146-199              Transcript 1 (1)
           Transcript 1 (2) -------------------------------------------Exon 1.3  PDB: B:45-76          --------------------------------------------------------------------------------------------------------------------------- Transcript 1 (2)
                 2cvd B   2 PNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGMSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL 199
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191

Chain C from PDB  Type:PROTEIN  Length:198
 aligned with HPGDS_HUMAN | O60760 from UniProtKB/Swiss-Prot  Length:199

    Alignment length:198
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191        
          HPGDS_HUMAN     2 PNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL 199
               SCOP domains d2cvdc2 C:2-75 Class sigma GST                                            d2cvdc1 C:76-199 Class sigma GST                                                                                             SCOP domains
               CATH domains 2cvdC01 C:2-75,C:184-199 Glutaredoxin                                     2cvdC02 C:76-183  [code=1.20.1050.10, no name defined]                                                      2cvdC01          CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..eeeeee..hhhhhhhhhhhhhhh...eeeeehhhhhhhhhh........eeee..eeeehhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhhhhhh..........hhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE GST_NTER  PDB: C:2-79 UniProt: 2-79                                           -GST_CTER  PDB: C:81-199 UniProt: 81-199                                                                                 PROSITE
           Transcript 1 (1) Exon 1.2a  PDB: C:2-45 UniProt: 1-45        ------------------------------Exon 1.4  PDB: C:76-112              Exon 1.6  PDB: C:113-145         Exon 1.7  PDB: C:146-199 UniProt: 146-199              Transcript 1 (1)
           Transcript 1 (2) -------------------------------------------Exon 1.3  PDB: C:45-76          --------------------------------------------------------------------------------------------------------------------------- Transcript 1 (2)
                 2cvd C   2 PNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGMSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL 199
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191

Chain D from PDB  Type:PROTEIN  Length:198
 aligned with HPGDS_HUMAN | O60760 from UniProtKB/Swiss-Prot  Length:199

    Alignment length:198
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191        
          HPGDS_HUMAN     2 PNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL 199
               SCOP domains d2cvdd2 D:2-75 Class sigma GST                                            d2cvdd1 D:76-199 Class sigma GST                                                                                             SCOP domains
               CATH domains 2cvdD01 D:2-75,D:184-199 Glutaredoxin                                     2cvdD02 D:76-183  [code=1.20.1050.10, no name defined]                                                      2cvdD01          CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..eeeeee..hhhhhhhhhhhhhhh...eeeeehhhhhhhhhh........eeee..eeeehhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhhhhhh..........hhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE GST_NTER  PDB: D:2-79 UniProt: 2-79                                           -GST_CTER  PDB: D:81-199 UniProt: 81-199                                                                                 PROSITE
           Transcript 1 (1) Exon 1.2a  PDB: D:2-45 UniProt: 1-45        ------------------------------Exon 1.4  PDB: D:76-112              Exon 1.6  PDB: D:113-145         Exon 1.7  PDB: D:146-199 UniProt: 146-199              Transcript 1 (1)
           Transcript 1 (2) -------------------------------------------Exon 1.3  PDB: D:45-76          --------------------------------------------------------------------------------------------------------------------------- Transcript 1 (2)
                 2cvd D   2 PNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGMSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL 199
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: All alpha proteins (14657)

Fold: GST C-terminal domain-like (353)

Superfamily: GST C-terminal domain-like (353)

Family: Glutathione S-transferase (GST), C-terminal domain (263)

Protein domain: Class sigma GST (12)

Human (Homo sapiens) [TaxId: 9606] (7)

1a	d2cvda1	A:76-199
1b	d2cvdb1	B:76-199
1c	d2cvdc1	C:76-199
1d	d2cvdd1	D:76-199

Class: Alpha and beta proteins (a/b) (23833)

Fold: Thioredoxin fold (994)

Superfamily: Thioredoxin-like (992)

Family: Glutathione S-transferase (GST), N-terminal domain (216)

Protein domain: Class sigma GST (12)

Human (Homo sapiens) [TaxId: 9606] (7)

2a	d2cvda2	A:2-75
2b	d2cvdb2	B:2-75
2c	d2cvdc2	C:2-75
2d	d2cvdd2	D:2-75

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: 3-Layer(aba) Sandwich (12045)

Topology: Glutaredoxin (620)

Homologous Superfamily: Glutaredoxin (617)

Human (Homo sapiens) (186)

1a	2cvdA01	A:2-75,A:184-199
1b	2cvdB01	B:2-75,B:184-199
1c	2cvdC01	C:2-75,C:184-199
1d	2cvdD01	D:2-75,D:184-199

Class: Mainly Alpha (13335)

Architecture: Up-down Bundle (3216)

Topology: Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 (267)

Homologous Superfamily: [code=1.20.1050.10, no name defined] (249)

Human (Homo sapiens) (119)

2a	2cvdA02	A:76-183
2b	2cvdB02	B:76-183
2c	2cvdC02	C:76-183
2d	2cvdD02	D:76-183

(no "Pfam Domain" information available for 2CVD)

Asymmetric Unit(hide GO term definitions)

Chain A,B,C,D (HPGDS_HUMAN | O60760)

molecular function
	GO:0005509	calcium ion binding	Interacting selectively and non-covalently with calcium ions (Ca2+).
	GO:0004364	glutathione transferase activity	Catalysis of the reaction: R-X + glutathione = H-X + R-S-glutathione. R may be an aliphatic, aromatic or heterocyclic group; X may be a sulfate, nitrile or halide group.
	GO:0016853	isomerase activity	Catalysis of the geometric or structural changes within one molecule. Isomerase is the systematic name for any enzyme of EC class 5.
	GO:0000287	magnesium ion binding	Interacting selectively and non-covalently with magnesium (Mg) ions.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0004667	prostaglandin-D synthase activity	Catalysis of the reaction: prostaglandin H(2) = prostaglandin D(2).
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0042803	protein homodimerization activity	Interacting selectively and non-covalently with an identical protein to form a homodimer.
	GO:0016740	transferase activity	Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
	GO:0019371	cyclooxygenase pathway	The chemical reactions and pathways by which prostaglandins are formed from arachidonic acid, and in which prostaglandin-endoperoxide synthase (cyclooxygenase) catalyzes the committed step in the conversion of arachidonic acid to the prostaglandin-endoperoxides PGG2 and PGH2.
	GO:0006633	fatty acid biosynthetic process	The chemical reactions and pathways resulting in the formation of a fatty acid, any of the aliphatic monocarboxylic acids that can be liberated by hydrolysis from naturally occurring fats and oils. Fatty acids are predominantly straight-chain acids of 4 to 24 carbon atoms, which may be saturated or unsaturated; branched fatty acids and hydroxy fatty acids also occur, and very long chain acids of over 30 carbons are found in waxes.
	GO:0006631	fatty acid metabolic process	The chemical reactions and pathways involving fatty acids, aliphatic monocarboxylic acids liberated from naturally occurring fats and oils by hydrolysis.
	GO:1901687	glutathione derivative biosynthetic process	The chemical reactions and pathways resulting in the formation of glutathione derivative.
	GO:0006629	lipid metabolic process	The chemical reactions and pathways involving lipids, compounds soluble in an organic solvent but not, or sparingly, in an aqueous solvent. Includes fatty acids; neutral fats, other fatty-acid esters, and soaps; long-chain (fatty) alcohols and waxes; sphingoids and other long-chain bases; glycolipids, phospholipids and sphingolipids; and carotenes, polyprenols, sterols, terpenes and other isoprenoids.
	GO:0007626	locomotory behavior	The specific movement from place to place of an organism in response to external or internal stimuli. Locomotion of a whole organism in a manner dependent upon some combination of that organism's internal state and external conditions.
	GO:2000255	negative regulation of male germ cell proliferation	Any process that stops, prevents or reduces the frequency, rate or extent of male germ cell proliferation.
	GO:0001516	prostaglandin biosynthetic process	The chemical reactions and pathways resulting in the formation of prostaglandins, any of a group of biologically active metabolites which contain a cyclopentane ring.
	GO:0006693	prostaglandin metabolic process	The chemical reactions and pathways involving prostaglandins, any of a group of biologically active metabolites which contain a cyclopentane ring due to the formation of a bond between two carbons of a fatty acid. They have a wide range of biological activities.
	GO:0007165	signal transduction	The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		GOL	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		GSH	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		HQL	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		MG	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]
		AC7	[ RasMol ]	+environment [ RasMol ]
		AC8	[ RasMol ]	+environment [ RasMol ]
		AC9	[ RasMol ]	+environment [ RasMol ]
		BC1	[ RasMol ]	+environment [ RasMol ]
		BC2	[ RasMol ]	+environment [ RasMol ]
		BC3	[ RasMol ]	+environment [ RasMol ]
		BC4	[ RasMol ]	+environment [ RasMol ]
		BC5	[ RasMol ]	+environment [ RasMol ]
		BC6	[ RasMol ]	+environment [ RasMol ]
		BC7	[ RasMol ]	+environment [ RasMol ]
		BC8	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Ile A:51 - Pro A:52	[ RasMol ]
		Ile B:51 - Pro B:52	[ RasMol ]
		Ile C:51 - Pro C:52	[ RasMol ]
		Ile D:51 - Pro D:52	[ RasMol ]

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format \| Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	2cvd
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	HPGDS_HUMAN \| O60760
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	HPGDS_HUMAN \| O60760
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

1iyh	GLUTHATIONE-S-TRANSFERASE
1iyi	GLUTHATIONE-S-TRANSFERASE

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (4, 17)

Sites (17, 17)

SS Bonds (0, 0)

Cis Peptide Bonds (4, 4)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (2, 8)

Exons (5, 20)

Sequences/Alignments

Classification and Annotation

SCOP Domains (2, 8)

CATH Domains (2, 8)

Pfam Domains (0, 0)

Gene Ontology (21, 21)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File