1IYH - JenaLib

Asym.Unit - manually (Jmol Viewer)

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF HEMATOPOIETIC PROSTAGLANDIN D SYNTHASE

Authors :   T. Inoue

Date :   26 Aug 02 (Deposition) - 08 Apr 03 (Release) - 16 Apr 14 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.70

Chains :   Asym. Unit : A,B,C,D
Biol. Unit 1: A,C  (1x)
Biol. Unit 2: B,D  (1x)

Keywords :   Hematopoietic Prostaglandin D Synthase, Pgds, Gst, Sigma-Class Gst, Ligase, Isomerase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   T. Inoue, D. Irikura, N. Okazaki, S. Kinugasa, H. Matsumura, N. Uodome M. Yamamoto, T. Kumasaka, M. Miyano, Y. Kai, Y. Urade
Mechanism Of Metal Activation Of Human Hematopoietic Prostaglandin D Synthase
Nat. Struct. Biol. V. 10 291 2003
PubMed-ID: 12627223 | Reference-DOI: 10.1038/NSB907

Molecule 1 - HEMATOPOIETIC PROSTAGLANDIN D SYNTHASE
	Chains	:	A, B, C, D
	EC Number	:	5.3.99.2
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Taxid	:	562
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606

		1	2	3	4
Asymmetric Unit	:	A	B	C	D
Biological Unit 1 (1x)	:	A		C
Biological Unit 2 (1x)	:		B		D

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (2, 6)

No.	Name	Count	Type	Full Name
1	GSH	4	Ligand/Ion	GLUTATHIONE
2	MG	2	Ligand/Ion	MAGNESIUM ION

Biological Unit 1 (1, 2)

No.	Name	Count	Type	Full Name
1	GSH	2	Ligand/Ion	GLUTATHIONE
2	MG	-1	Ligand/Ion	MAGNESIUM ION

Biological Unit 2 (1, 2)

No.	Name	Count	Type	Full Name
1	GSH	2	Ligand/Ion	GLUTATHIONE
2	MG	-1	Ligand/Ion	MAGNESIUM ION

Asymmetric Unit (6, 6)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	HOH A:1902 , HOH A:1903 , HOH A:1904 , HOH C:1601 , HOH C:1602 , HOH C:1603	BINDING SITE FOR RESIDUE MG A 1901
2	AC2	SOFTWARE	HOH B:1903 , HOH B:1904 , HOH B:1905 , HOH D:1801 , HOH D:1802 , HOH D:1803	BINDING SITE FOR RESIDUE MG B 1902
3	AC3	SOFTWARE	TYR A:8 , ARG A:14 , TRP A:39 , LYS A:50 , ILE A:51 , PRO A:52 , GLN A:63 , SER A:64 , HOH A:1917 , HOH A:1973 , HOH A:1976 , HOH A:1984 , HOH A:2019 , HOH A:2049 , HOH A:2121 , HOH A:2132 , ASP C:497	BINDING SITE FOR RESIDUE GSH A 1200
4	AC4	SOFTWARE	TYR B:208 , ARG B:214 , TRP B:239 , LYS B:243 , LYS B:250 , ILE B:251 , PRO B:252 , GLN B:263 , SER B:264 , HOH B:1910 , HOH B:1953 , HOH B:1986 , HOH B:2111 , ASP D:697 , HOH D:1979	BINDING SITE FOR RESIDUE GSH B 1400
5	AC5	SOFTWARE	ASP A:97 , TYR C:408 , ARG C:414 , TRP C:439 , LYS C:443 , LYS C:450 , ILE C:451 , PRO C:452 , GLN C:463 , SER C:464 , HOH C:1628 , HOH C:1648 , HOH C:1727 , HOH C:1776	BINDING SITE FOR RESIDUE GSH C 1600
6	AC6	SOFTWARE	ASP B:297 , TYR D:608 , ARG D:614 , TRP D:639 , LYS D:643 , LYS D:650 , ILE D:651 , GLN D:663 , SER D:664 , HOH D:1811 , HOH D:1829 , HOH D:1838 , HOH D:1954	BINDING SITE FOR RESIDUE GSH D 1800

(no "SS Bond" information available for 1IYH)

Asymmetric Unit

No.	Residues
1	Ile A:51	-	Pro A:52
2	Ile B:251	-	Pro B:252
3	Ile C:451	-	Pro C:452
4	Ile D:651	-	Pro D:652

(no "SAP(SNP)/Variant" information available for 1IYH)

Asymmetric Unit (2, 8)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	GST_NTER	PS50404	Soluble glutathione S-transferase N-terminal domain profile.	HPGDS_HUMAN	2-79	4	A:2-79 B:202-279 C:402-479 D:602-679
2	GST_CTER	PS50405	Soluble glutathione S-transferase C-terminal domain profile.	HPGDS_HUMAN	81-199	4	A:81-199 B:281-399 C:481-599 D:681-799

Biological Unit 1 (2, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	GST_NTER	PS50404	Soluble glutathione S-transferase N-terminal domain profile.	HPGDS_HUMAN	2-79	2	A:2-79 - C:402-479 -
2	GST_CTER	PS50405	Soluble glutathione S-transferase C-terminal domain profile.	HPGDS_HUMAN	81-199	2	A:81-199 - C:481-599 -

Biological Unit 2 (2, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	GST_NTER	PS50404	Soluble glutathione S-transferase N-terminal domain profile.	HPGDS_HUMAN	2-79	2	- B:202-279 - D:602-679
2	GST_CTER	PS50405	Soluble glutathione S-transferase C-terminal domain profile.	HPGDS_HUMAN	81-199	2	- B:281-399 - D:681-799

Asymmetric Unit (5, 20)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1a	ENST00000295256	1a	ENSE00001428701	chr4:95264027-95263946	82	HPGDS_HUMAN	-	0	0	-	-
1.2a	ENST00000295256	2a	ENSE00002147371	chr4:95255789-95255648	142	HPGDS_HUMAN	1-45	45	4	A:2-45 B:202-245 C:402-445 D:602-645	44 44 44 44
1.3	ENST00000295256	3	ENSE00001238639	chr4:95239116-95239024	93	HPGDS_HUMAN	45-76	32	4	A:45-76 B:245-276 C:445-476 D:645-676	32 32 32 32
1.4	ENST00000295256	4	ENSE00001071670	chr4:95229894-95229785	110	HPGDS_HUMAN	76-112	37	4	A:76-112 B:276-312 C:476-512 D:676-712	37 37 37 37
1.6	ENST00000295256	6	ENSE00001071668	chr4:95223395-95223297	99	HPGDS_HUMAN	113-145	33	4	A:113-145 B:313-345 C:513-545 D:713-745	33 33 33 33
1.7	ENST00000295256	7	ENSE00001302624	chr4:95220795-95219686	1110	HPGDS_HUMAN	146-199	54	4	A:146-199 B:346-399 C:546-599 D:746-799	54 54 54 54

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:198
 aligned with HPGDS_HUMAN | O60760 from UniProtKB/Swiss-Prot  Length:199

    Alignment length:198
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191        
          HPGDS_HUMAN     2 PNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL 199
               SCOP domains d1iyha2 A:2-75 Class sigma GST                                            d1iyha1 A:76-199 Class sigma GST                                                                                             SCOP domains
               CATH domains 1iyhA01 A:2-75,A:184-199 Glutaredoxin                                     1iyhA02 A:76-183  [code=1.20.1050.10, no name defined]                                                      1iyhA01          CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..eeeeee..hhhhhhhhhhhhhh....eeeeehhhhhhhhhh........eeee..eeeehhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhhhhhh..........hhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE GST_NTER  PDB: A:2-79 UniProt: 2-79                                           -GST_CTER  PDB: A:81-199 UniProt: 81-199                                                                                 PROSITE
           Transcript 1 (1) Exon 1.2a  PDB: A:2-45 UniProt: 1-45        ------------------------------Exon 1.4  PDB: A:76-112              Exon 1.6  PDB: A:113-145         Exon 1.7  PDB: A:146-199 UniProt: 146-199              Transcript 1 (1)
           Transcript 1 (2) -------------------------------------------Exon 1.3  PDB: A:45-76          --------------------------------------------------------------------------------------------------------------------------- Transcript 1 (2)
                 1iyh A   2 PNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGMSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL 199
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191

Chain B from PDB  Type:PROTEIN  Length:198
 aligned with HPGDS_HUMAN | O60760 from UniProtKB/Swiss-Prot  Length:199

    Alignment length:198
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191        
          HPGDS_HUMAN     2 PNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL 199
               SCOP domains d1iyhb2 B:202-275 Class sigma GST                                         d1iyhb1 B:276-399 Class sigma GST                                                                                            SCOP domains
               CATH domains -1iyhB01 B:203-277,B:386-399 Glutaredoxin                                   1iyhB02 B:278-385  [code=1.20.1050.10, no name defined]                                                     1iyhB01        CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..eeeeee..hhhhhhhhhhhhhhh...eeeeehhhhhhhhhh........eeee..eeeehhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhhhhhh..........hhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE GST_NTER  PDB: B:202-279 UniProt: 2-79                                        -GST_CTER  PDB: B:281-399 UniProt: 81-199                                                                                PROSITE
           Transcript 1 (1) Exon 1.2a  PDB: B:202-245 UniProt: 1-45     ------------------------------Exon 1.4  PDB: B:276-312             Exon 1.6  PDB: B:313-345         Exon 1.7  PDB: B:346-399 UniProt: 146-199              Transcript 1 (1)
           Transcript 1 (2) -------------------------------------------Exon 1.3  PDB: B:245-276        --------------------------------------------------------------------------------------------------------------------------- Transcript 1 (2)
                 1iyh B 202 PNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGMSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL 399
                                   211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391

Chain C from PDB  Type:PROTEIN  Length:198
 aligned with HPGDS_HUMAN | O60760 from UniProtKB/Swiss-Prot  Length:199

    Alignment length:198
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191        
          HPGDS_HUMAN     2 PNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL 199
               SCOP domains d1iyhc2 C:402-475 Class sigma GST                                         d1iyhc1 C:476-599 Class sigma GST                                                                                            SCOP domains
               CATH domains -1iyhC01 C:403-477,C:586-599 Glutaredoxin                                   1iyhC02 C:478-585  [code=1.20.1050.10, no name defined]                                                     1iyhC01        CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..eeeeee.....hhhhhhhhhhh....eeeeehhhhhhhhhh........eeee..eeeehhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhhhhhh..........hhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE GST_NTER  PDB: C:402-479 UniProt: 2-79                                        -GST_CTER  PDB: C:481-599 UniProt: 81-199                                                                                PROSITE
           Transcript 1 (1) Exon 1.2a  PDB: C:402-445 UniProt: 1-45     ------------------------------Exon 1.4  PDB: C:476-512             Exon 1.6  PDB: C:513-545         Exon 1.7  PDB: C:546-599 UniProt: 146-199              Transcript 1 (1)
           Transcript 1 (2) -------------------------------------------Exon 1.3  PDB: C:445-476        --------------------------------------------------------------------------------------------------------------------------- Transcript 1 (2)
                 1iyh C 402 PNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGMSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL 599
                                   411       421       431       441       451       461       471       481       491       501       511       521       531       541       551       561       571       581       591

Chain D from PDB  Type:PROTEIN  Length:198
 aligned with HPGDS_HUMAN | O60760 from UniProtKB/Swiss-Prot  Length:199

    Alignment length:198
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191        
          HPGDS_HUMAN     2 PNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL 199
               SCOP domains d1iyhd2 D:602-675 Class sigma GST                                         d1iyhd1 D:676-799 Class sigma GST                                                                                            SCOP domains
               CATH domains 1iyhD01 D:602-677,D:786-799 Glutaredoxin                                    1iyhD02 D:678-785  [code=1.20.1050.10, no name defined]                                                     1iyhD01        CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..eeeeee..hhhhhhhhhhhhhh....eeeeehhhhhhhhhh........eeee..eeeehhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhh..........hhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE GST_NTER  PDB: D:602-679 UniProt: 2-79                                        -GST_CTER  PDB: D:681-799 UniProt: 81-199                                                                                PROSITE
           Transcript 1 (1) Exon 1.2a  PDB: D:602-645 UniProt: 1-45     ------------------------------Exon 1.4  PDB: D:676-712             Exon 1.6  PDB: D:713-745         Exon 1.7  PDB: D:746-799 UniProt: 146-199              Transcript 1 (1)
           Transcript 1 (2) -------------------------------------------Exon 1.3  PDB: D:645-676        --------------------------------------------------------------------------------------------------------------------------- Transcript 1 (2)
                 1iyh D 602 PNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGMSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL 799
                                   611       621       631       641       651       661       671       681       691       701       711       721       731       741       751       761       771       781       791

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: All alpha proteins (14657)

Fold: GST C-terminal domain-like (353)

Superfamily: GST C-terminal domain-like (353)

Family: Glutathione S-transferase (GST), C-terminal domain (263)

Protein domain: Class sigma GST (12)

Human (Homo sapiens) [TaxId: 9606] (7)

1a	d1iyha1	A:76-199
1b	d1iyhb1	B:276-399
1c	d1iyhc1	C:476-599
1d	d1iyhd1	D:676-799

Class: Alpha and beta proteins (a/b) (23833)

Fold: Thioredoxin fold (994)

Superfamily: Thioredoxin-like (992)

Family: Glutathione S-transferase (GST), N-terminal domain (216)

Protein domain: Class sigma GST (12)

Human (Homo sapiens) [TaxId: 9606] (7)

2a	d1iyha2	A:2-75
2b	d1iyhb2	B:202-275
2c	d1iyhc2	C:402-475
2d	d1iyhd2	D:602-675

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: 3-Layer(aba) Sandwich (12045)

Topology: Glutaredoxin (620)

Homologous Superfamily: Glutaredoxin (617)

Human (Homo sapiens) (186)

1a	1iyhA01	A:2-75,A:184-199
1b	1iyhD01	D:602-677,D:786-799
1c	1iyhB01	B:203-277,B:386-399
1d	1iyhC01	C:403-477,C:586-599

Class: Mainly Alpha (13335)

Architecture: Up-down Bundle (3216)

Topology: Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 (267)

Homologous Superfamily: [code=1.20.1050.10, no name defined] (249)

Human (Homo sapiens) (119)

2a	1iyhA02	A:76-183
2b	1iyhB02	B:278-385
2c	1iyhC02	C:478-585
2d	1iyhD02	D:678-785

(no "Pfam Domain" information available for 1IYH)

Asymmetric Unit(hide GO term definitions)

Chain A,B,C,D (HPGDS_HUMAN | O60760)

molecular function
	GO:0005509	calcium ion binding	Interacting selectively and non-covalently with calcium ions (Ca2+).
	GO:0004364	glutathione transferase activity	Catalysis of the reaction: R-X + glutathione = H-X + R-S-glutathione. R may be an aliphatic, aromatic or heterocyclic group; X may be a sulfate, nitrile or halide group.
	GO:0016853	isomerase activity	Catalysis of the geometric or structural changes within one molecule. Isomerase is the systematic name for any enzyme of EC class 5.
	GO:0000287	magnesium ion binding	Interacting selectively and non-covalently with magnesium (Mg) ions.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0004667	prostaglandin-D synthase activity	Catalysis of the reaction: prostaglandin H(2) = prostaglandin D(2).
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0042803	protein homodimerization activity	Interacting selectively and non-covalently with an identical protein to form a homodimer.
	GO:0016740	transferase activity	Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
	GO:0019371	cyclooxygenase pathway	The chemical reactions and pathways by which prostaglandins are formed from arachidonic acid, and in which prostaglandin-endoperoxide synthase (cyclooxygenase) catalyzes the committed step in the conversion of arachidonic acid to the prostaglandin-endoperoxides PGG2 and PGH2.
	GO:0006633	fatty acid biosynthetic process	The chemical reactions and pathways resulting in the formation of a fatty acid, any of the aliphatic monocarboxylic acids that can be liberated by hydrolysis from naturally occurring fats and oils. Fatty acids are predominantly straight-chain acids of 4 to 24 carbon atoms, which may be saturated or unsaturated; branched fatty acids and hydroxy fatty acids also occur, and very long chain acids of over 30 carbons are found in waxes.
	GO:0006631	fatty acid metabolic process	The chemical reactions and pathways involving fatty acids, aliphatic monocarboxylic acids liberated from naturally occurring fats and oils by hydrolysis.
	GO:1901687	glutathione derivative biosynthetic process	The chemical reactions and pathways resulting in the formation of glutathione derivative.
	GO:0006629	lipid metabolic process	The chemical reactions and pathways involving lipids, compounds soluble in an organic solvent but not, or sparingly, in an aqueous solvent. Includes fatty acids; neutral fats, other fatty-acid esters, and soaps; long-chain (fatty) alcohols and waxes; sphingoids and other long-chain bases; glycolipids, phospholipids and sphingolipids; and carotenes, polyprenols, sterols, terpenes and other isoprenoids.
	GO:0007626	locomotory behavior	The specific movement from place to place of an organism in response to external or internal stimuli. Locomotion of a whole organism in a manner dependent upon some combination of that organism's internal state and external conditions.
	GO:2000255	negative regulation of male germ cell proliferation	Any process that stops, prevents or reduces the frequency, rate or extent of male germ cell proliferation.
	GO:0001516	prostaglandin biosynthetic process	The chemical reactions and pathways resulting in the formation of prostaglandins, any of a group of biologically active metabolites which contain a cyclopentane ring.
	GO:0006693	prostaglandin metabolic process	The chemical reactions and pathways involving prostaglandins, any of a group of biologically active metabolites which contain a cyclopentane ring due to the formation of a bond between two carbons of a fatty acid. They have a wide range of biological activities.
	GO:0007165	signal transduction	The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		GSH	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		MG	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Ile A:51 - Pro A:52	[ RasMol ]
		Ile B:251 - Pro B:252	[ RasMol ]
		Ile C:451 - Pro C:452	[ RasMol ]
		Ile D:651 - Pro D:652	[ RasMol ]

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format \| Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1iyh
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	HPGDS_HUMAN \| O60760
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	5.3.99.2
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	HPGDS_HUMAN \| O60760
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

1iyi	1IYI CONTAINS THE SAME PROTEIN COMPLEXED WITH GLUTATHIONE IN THE PRESENCE OF CA2+

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (2, 6)

Sites (6, 6)

SS Bonds (0, 0)

Cis Peptide Bonds (4, 4)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (2, 8)

Exons (5, 20)

Sequences/Alignments

Classification and Annotation

SCOP Domains (2, 8)

CATH Domains (2, 8)

Pfam Domains (0, 0)

Gene Ontology (21, 21)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File