Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - manually
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - manually
NMR Structure - manually  (Jmol Viewer)
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  SOLUTION STRUCTURE OF THE SH2 DOMAIN OF HUMAN SH3BP2 PROTEIN
 
Authors :  R. Hatta, T. Tomizawa, F. Hayashi, M. Yoshida, S. Yokoyama, Riken Structural Genomics/Proteomics Initiative (Rsgi)
Date :  20 May 05  (Deposition) - 20 Nov 05  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (20x)
Keywords :  Sh2 Domain, 3Bp-2, Structural Genomics, Nppsfa, National Project On Protein Structural And Functional Analyses, Riken Structural Genomics/Proteomics Initiative, Rsgi, Signaling Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  R. Hatta, T. Tomizawa, F. Hayashi, M. Yoshida, S. Yokoyama
Solution Structure Of The Sh2 Domain Of Human Sh3Bp2 Protein
To Be Published
PubMed: search
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - SH3 DOMAIN-BINDING PROTEIN 2
    ChainsA
    EngineeredYES
    Expression System PlasmidP040607-02
    Expression System Vector TypePLASMID
    FragmentSH2 DOMAIN
    GeneSH3BP2
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    Other DetailsCELL FREE PROTEIN SYNTHESIS
    Synonym3BP-2

 Structural Features

(-) Chains, Units

  
NMR Structure (20x)

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2CR4)

(-) Sites  (0, 0)

(no "Site" information available for 2CR4)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2CR4)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2CR4)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2CR4)

(-) PROSITE Motifs  (1, 1)

NMR Structure (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1SH2PS50001 Src homology 2 (SH2) domain profile.3BP2_HUMAN457-555  1A:19-117

(-) Exons   (5, 5)

NMR Structure (5, 5)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.13bENST0000035633113bENSE00001338971chr4:2820541-28207972573BP2_HUMAN-00--
1.14aENST0000035633114aENSE00002140445chr4:2822341-28224801403BP2_HUMAN1-46460--
1.15ENST0000035633115ENSE00000854861chr4:2824662-28247641033BP2_HUMAN46-80350--
1.17bENST0000035633117bENSE00001294178chr4:2826340-28264571183BP2_HUMAN80-119400--
1.17kENST0000035633117kENSE00002152783chr4:2826853-2826923713BP2_HUMAN120-143240--
1.18fENST0000035633118fENSE00002142654chr4:2828957-2829045893BP2_HUMAN143-173310--
1.19cENST0000035633119cENSE00000699174chr4:2829333-2829401693BP2_HUMAN173-196240--
1.20cENST0000035633120cENSE00001301413chr4:2831220-28318746553BP2_HUMAN196-4142190--
1.21ENST0000035633121ENSE00001507036chr4:2833298-28334061093BP2_HUMAN414-450371A:1-12 (gaps)14
1.22aENST0000035633122aENSE00001507035chr4:2833650-2833705563BP2_HUMAN451-469191A:13-3119
1.22cENST0000035633122cENSE00000854878chr4:2834058-2834139823BP2_HUMAN469-496281A:31-5828
1.23bENST0000035633123bENSE00000699192chr4:2834717-2834776603BP2_HUMAN497-516201A:59-7820
1.23jENST0000035633123jENSE00002020330chr4:2835424-284282574023BP2_HUMAN517-561451A:79-12446

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:126
 aligned with 3BP2_HUMAN | P78314 from UniProtKB/Swiss-Prot  Length:561

    Alignment length:128
                                                                                                                                                       561  
                                                                                                                                                     559 |  
                                                                                                                                                   558 | |  
                                   446       456       466       476       486       496       506       516       526       536       546       556 | | |  
           3BP2_HUMAN   437 ADTGGDDSDEDYEKVPLPNSVFVNTTESCEVERLFKATSPRGEPQDGLYCIRNSSTKSGKVLVVWDETSNKVRNYRIFEKDSKFYLEGEVLFVSVGSMVEHYHTHVLPSHQSLLLRHPYGYT-GPR--   -
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....--....................hhhhhhhhhhhhh.........eeeee......eeeee..........ee.eee..eee.....ee.hhhhhhhhhh......................... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------SH2  PDB: A:19-117 UniProt: 457-555                                                                --------- PROSITE
           Transcript 1 (1) Exon 1.21     Exon 1.22a         ---------------------------Exon 1.23b          Exon 1.23j  PDB: A:79-124 UniProt: 517-561    -- Transcript 1 (1)
           Transcript 1 (2) --------------------------------Exon 1.22c  PDB: A:31-58    -------------------------------------------------------------------- Transcript 1 (2)
                 2cr4 A   1 GSSG--SSGEDYEKVPLPNSVFVNTTESCEVERLFKATSPRGEPQDGLYCIRNSSTKSGKVLVVWDETSNKVRNYRIFEKDSKFYLEGEVLFVSVGSMVEHYHTHVLPSHQSLLLRHPYGYTSGPSSG 126
                               |  |  8        18        28        38        48        58        68        78        88        98       108       118        
                               4  5                                                                                                                         

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2CR4)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2CR4)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2CR4)

(-) Gene Ontology  (5, 5)

NMR Structure(hide GO term definitions)
Chain A   (3BP2_HUMAN | P78314)
molecular function
    GO:0017124    SH3 domain binding    Interacting selectively and non-covalently with a SH3 domain (Src homology 3) of a protein, small protein modules containing approximately 50 amino acid residues found in a great variety of intracellular or membrane-associated proteins.
    GO:0005070    SH3/SH2 adaptor activity    Interacting selectively and non-covalently and simultaneously with one or more signal transduction molecules, usually acting as a scaffold to bring these molecules into close proximity either using their own SH2/SH3 domains (e.g. Grb2) or those of their target molecules (e.g. SAM68).
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
    GO:0009967    positive regulation of signal transduction    Any process that activates or increases the frequency, rate or extent of signal transduction.
    GO:0007165    signal transduction    The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2cr4)
 
  Sites
(no "Sites" information available for 2cr4)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2cr4)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2cr4
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  3BP2_HUMAN | P78314
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  3BP2_HUMAN | P78314
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        3BP2_HUMAN | P783143twr

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2CR4)