Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym.Unit - manually
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
collapse expand < >
Image Asym.Unit - manually
Asym.Unit - manually  (Jmol Viewer)
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF MESORHIZOBIUM LOTI ARYLAMINE N-ACETYLTRANSFERASE 1
 
Authors :  S. J. Holton, J. Dairou, J. Sandy, F. Rodrigues-Lima, J. -M. Dupret, M. E. M. Noble, E. Sim
Date :  24 May 05  (Deposition) - 25 May 05  (Release) - 27 Mar 13  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.00
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Keywords :  Acyltransferase, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  S. J. Holton, J. Dairou, J. Sandy, F. Rodrigues-Lima, J. M. Dupret, M. E. M. Noble, E. Sim
Structure Of Mesorhizobium Loti Arylamine N- Acetyltransferase 1.
Acta Crystallogr. , Sect. F V. 61 14 2005
PubMed-ID: 16508079  |  Reference-DOI: 10.1107/S1744309104030659

(-) Compounds

Molecule 1 - ARYLAMINE N-ACETYLTRANSFERASE 1
    Chains: A, B
    EC Number: 2.3.1.5
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Organism Scientific: RHIZOBIUM LOTI
    Organism Taxid: 381

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit : AB
Biological Unit 1 (1x): A 
Biological Unit 2 (1x):  B

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2BSZ)

(-) Sites  (0, 0)

(no "Site" information available for 2BSZ)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2BSZ)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2BSZ)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2BSZ)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2BSZ)

(-) Exons   (0, 0)

(no "Exon" information available for 2BSZ)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:267
 aligned with Q98D42_RHILO | Q98D42 from UniProtKB/TrEMBL  Length:278

    Alignment length:270
                                    15        25        35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275
         Q98D42_RHILO     6 PFDLDAYLARIGYTGPRNASLDTLKALHFAHPQAIPFENIDPFLGRPVRLDLAALQDKIVLGGRGGYCFEHNLLFMHALKALGFEVGGLAARVLWGQSEDAITARSHMLLRVELDGRTYIADVGFGGLTLTAPLLLEPGREQKTPHEPFRIVEADDHFRLQAAIGGDWRSLYRFDLQPQYEVDYSVTNYFLSTSPTSHFLSSVIAARAAPDRRYALRGNRLSIHHLGGRTEQTEIATAADLADTLQGLLGIIIPDRTAFEAKVRETKIVE 275
               SCOP domains d2bsza1 A:6-275 Arylamine N-acetyltransferase                                                                                                                                                                                                                                  SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..hhhhhhhhhh.......hhhhhhhhhhhhhhhh.eehhhhhh......hhhhhhhhhh......hhhhhhhhhhhhhhhhh.eeeeeeeee.............eeeeeeee..eeeee............ee.....ee......eeeee....eeeeeee..eeeeeeee.....hhhhhhhhhhhhhhh..hhhhhh.eeeee...eeeeee..eeeeee.---.eeee..hhhhhhhhhhh.......hhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 2bsz A   6 PFDLDAYLARIGYTGPRNASLDTLKALHFAHPQAIPFENIDPFLGRPVRLDLAALQDKIVLGGRGGYCFEHNLLFMHALKALGFEVGGLAARVLWGQSEDAITARSHMLLRVELDGRTYIADVGFGGLTLTAPLLLEPGREQKTPHEPFRIVEADDHFRLQAAIGGDWRSLYRFDLQPQYEVDYSVTNYFLSTSPTSHFLSSVIAARAAPDRRYALRGNRLSIHHL---TEQTEIATAADLADTLQGLLGIIIPDRTAFEAKVRETKIVE 275
                                    15        25        35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225     | 235       245       255       265       275
                                                                                                                                                                                                                                                           231 235                                        


Chain B from PDB  Type:PROTEIN  Length:264
 aligned with Q98D42_RHILO | Q98D42 from UniProtKB/TrEMBL  Length:278

    Alignment length:268
                                    16        26        36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266        
         Q98D42_RHILO     7 FDLDAYLARIGYTGPRNASLDTLKALHFAHPQAIPFENIDPFLGRPVRLDLAALQDKIVLGGRGGYCFEHNLLFMHALKALGFEVGGLAARVLWGQSEDAITARSHMLLRVELDGRTYIADVGFGGLTLTAPLLLEPGREQKTPHEPFRIVEADDHFRLQAAIGGDWRSLYRFDLQPQYEVDYSVTNYFLSTSPTSHFLSSVIAARAAPDRRYALRGNRLSIHHLGGRTEQTEIATAADLADTLQGLLGIIIPDRTAFEAKVRETKIV 274
               SCOP domains d2bszb_ B: automated matches                                                                                                                                                                                                                                                 SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhh.......hhhhhhhhhhhhhhhh.eehhhhhh......hhhhhhhhhh......hhhhhhhhhhhhhhhh..eeeeeeeee.............eeeeeeee..eeeee............ee.....ee......eeeee....eeeeeee..eeeeeeee.....hhhhhhhhhhhhhhh..hhhhhh.eeeee....eeeee..eeeee.----.eeee..hhhhhhhhhhh.......hhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2bsz B   7 FDLDAYLARIGYTGPRNASLDTLKALHFAHPQAIPFENIDPFLGRPVRLDLAALQDKIVLGGRGGYCFEHNLLFMHALKALGFEVGGLAARVLWGQSEDAITARSHMLLRVELDGRTYIADVGFGGLTLTAPLLLEPGREQKTPHEPFRIVEADDHFRLQAAIGGDWRSLYRFDLQPQYEVDYSVTNYFLSTSPTSHFLSSVIAARAAPDRRYALRGNRLSIHH----TEQTEIATAADLADTLQGLLGIIIPDRTAFEAKVRETKIV 274
                                    16        26        36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226   |   236       246       256       266        
                                                                                                                                                                                                                                                         230  235
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 2)

Asymmetric Unit
(-)
Class: Alpha and beta proteins (a+b) (23004)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2BSZ)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2BSZ)

(-) Gene Ontology  (5, 5)

Asymmetric Unit(hide GO term definitions)
Chain A,B   (Q98D42_RHILO | Q98D42)
molecular function
    GO:0016407    acetyltransferase activity    Catalysis of the transfer of an acetyl group to an acceptor molecule.
    GO:0004060    arylamine N-acetyltransferase activity    Catalysis of the reaction: acetyl-CoA + an arylamine = CoA + an N-acetylarylamine.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
    GO:0016746    transferase activity, transferring acyl groups    Catalysis of the transfer of an acyl group from one compound (donor) to another (acceptor).
biological process
    GO:0008152    metabolic process    The chemical reactions and pathways, including anabolism and catabolism, by which living organisms transform chemical substances. Metabolic processes typically transform small molecules, but also include macromolecular processes such as DNA repair and replication, and protein synthesis and degradation.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2bsz)
 
  Sites
(no "Sites" information available for 2bsz)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2bsz)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Biol. Unit 1 PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2bsz
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q98D42_RHILO | Q98D42
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  2.3.1.5
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q98D42_RHILO | Q98D42
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        Q98D42_RHILO | Q98D42: 4nv7 4nv8

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2BSZ)