|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (3, 3)
Asymmetric Unit (3, 3)
|
Sites (3, 3)
Asymmetric Unit (3, 3)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 2BOW) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2BOW) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2BOW) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2BOW) |
Exons (0, 0)| (no "Exon" information available for 2BOW) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:130 aligned with BMRR_BACSU | P39075 from UniProtKB/Swiss-Prot Length:278 Alignment length:157 130 140 150 160 170 180 190 200 210 220 230 240 250 260 270 BMRR_BACSU 121 LGEVFVLDEEEIRIIQTEAEGIGPENVLNASYSKLKKFIESADGFTNNSYGATFSFQPYTSIDEMTYRHIFTPVLTNKQISSITPDMEITTIPKGRYACIAYNFSPEHYFLNLQKLIKYIADRQLTVVSDVYELIIPIHYSPKKQEEYRVEMKIRIA 277 SCOP domains d2bowa_ A: Multidrug-binding dom ain of transcription activat or BmrR SCOP domains CATH domains 2bowA00 A:2-158 Multidrug-efflux Transporter 1 Regulator Bmr r; Chain CATH domains Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 2bow A 2 LGEVFVLDEEEIRIIQTEAEGIGPENVLNASY----------------SYGATFSFQPYTSIDEMTYRHIFTPVLT---ISSITPDMEITTIPKGRYACIAYNFSPEHYFLNLQKLIKYIADRQLTVVSDVYELIIPIH--------YRVEMKIRIL 158 11 21 31 | - 51 61 71 | 81 91 101 111 121 131 |- 151 33 50 77 81 140 149
|
||||||||||||||||||||
SCOP Domains (1, 1)| Asymmetric Unit |
CATH Domains (1, 1)| Asymmetric Unit |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2BOW) |
Gene Ontology (3, 3)|
Asymmetric Unit(hide GO term definitions) Chain A (BMRR_BACSU | P39075)
|
||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|