Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - manually
(-)NMR Structure - model 1
(-)NMR Structure - model 1, sites
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - manually
NMR Structure - manually  (Jmol Viewer)
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - model 1, sites
NMR Structure - model 1, sites  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  SOLUTION STRUCTURE OF A CALMODULIN-TARGET PEPTIDE COMPLEX BY MULTIDIMENSIONAL NMR
 
Authors :  G. M. Clore, A. Bax, M. Ikura, A. M. Gronenborn
Date :  16 Jul 92  (Deposition) - 31 Jan 94  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A,B
Keywords :  Calcium-Binding Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  M. Ikura, G. M. Clore, A. M. Gronenborn, G. Zhu, C. B. Klee, A. Bax
Solution Structure Of A Calmodulin-Target Peptide Complex By Multidimensional Nmr.
Science V. 256 632 1992
PubMed-ID: 1585175
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - CALMODULIN
    ChainsA
    EngineeredYES
    OrganSKELETAL
    Organism CommonFRUIT FLY
    Organism ScientificDROSOPHILA MELANOGASTER
    Organism Taxid7227
 
Molecule 2 - MYOSIN LIGHT CHAIN KINASE
    ChainsB
    EngineeredYES

 Structural Features

(-) Chains, Units

  
NMR Structure 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 4)

NMR Structure (1, 4)
No.NameCountTypeFull Name
1CA4Ligand/IonCALCIUM ION

(-) Sites  (4, 4)

NMR Structure (4, 4)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREASP A:20 , ASP A:22 , ASP A:24 , THR A:26 , GLU A:31BINDING SITE FOR RESIDUE CA A 181
2AC2SOFTWAREASP A:56 , ASP A:58 , ASN A:60 , THR A:62 , GLU A:67BINDING SITE FOR RESIDUE CA A 182
3AC3SOFTWAREASP A:93 , ASP A:95 , ASN A:97 , PHE A:99 , GLU A:104BINDING SITE FOR RESIDUE CA A 183
4AC4SOFTWAREASP A:129 , ASP A:131 , ASP A:133 , GLN A:135 , GLU A:140BINDING SITE FOR RESIDUE CA A 184

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2BBM)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2BBM)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2BBM)

(-) PROSITE Motifs  (2, 8)

NMR Structure (2, 8)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1EF_HAND_2PS50222 EF-hand calcium-binding domain profile.CALM_DROME8-43
44-79
81-116
117-149
  4A:7-42
A:43-78
A:80-115
A:116-148
2EF_HAND_1PS00018 EF-hand calcium-binding domain.CALM_DROME21-33
57-69
94-106
130-142
  4A:20-32
A:56-68
A:93-105
A:129-141

(-) Exons   (0, 0)

(no "Exon" information available for 2BBM)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:148
 aligned with CALM_DROME | P62152 from UniProtKB/Swiss-Prot  Length:149

    Alignment length:148
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141        
           CALM_DROME     2 ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVTMMTSK 149
               SCOP domains d2bbma_ A: Calmodulin                                                                                                                                SCOP domains
               CATH domains 2bbmA01 A:1-77 EF-hand                                                       2bbmA02 A:78-148 EF-hand                                                CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....hhhhhhhhhhhhhhh.......hhhhhhhhhhhhhh...hhhhhhhhhh.........hhhhhhhhhhh.......hhhhhhhhhhhh.......hhhhhhhhhhhh....hhhhhhhhhhhhh.......hhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) ------EF_HAND_2  PDB: A:7-42 UniProt: 8-43EF_HAND_2  PDB: A:43-78             -EF_HAND_2  PDB: A:80-115            EF_HAND_2  PDB: A:116-148         PROSITE (1)
                PROSITE (2) -------------------EF_HAND_1    -----------------------EF_HAND_1    ------------------------EF_HAND_1    -----------------------EF_HAND_1    ------- PROSITE (2)
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2bbm A   1 ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVTMMTSK 148
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140        

Chain B from PDB  Type:PROTEIN  Length:26
 aligned with MYLK2_RABIT | P07313 from UniProtKB/Swiss-Prot  Length:608

    Alignment length:26
                                   587       597      
          MYLK2_RABIT   578 KRRWKKNFIAVSAANRFKKISSSGAL 603
               SCOP domains -------------------------- SCOP domains
               CATH domains -------------------------- CATH domains
               Pfam domains -------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) -------------------------- SAPs(SNPs)
                    PROSITE -------------------------- PROSITE
                 Transcript -------------------------- Transcript
                 2bbm B   1 KRRWKKNFIAVSAANRFKKISSSGAL  26
                                    10        20      

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure

(-) CATH Domains  (1, 2)

NMR Structure

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2BBM)

(-) Gene Ontology  (51, 53)

NMR Structure(hide GO term definitions)
Chain A   (CALM_DROME | P62152)
molecular function
    GO:0005509    calcium ion binding    Interacting selectively and non-covalently with calcium ions (Ca2+).
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0031489    myosin V binding    Interacting selectively and non-covalently with a class V myosin; myosin V is a dimeric molecule involved in intracellular transport.
    GO:0070855    myosin VI head/neck binding    Interacting selectively and non-covalently with the head/neck region of a myosin VI heavy chain.
    GO:0032036    myosin heavy chain binding    Interacting selectively and non-covalently with a heavy chain of a myosin complex.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
    GO:0030048    actin filament-based movement    Movement of organelles or other particles along actin filaments, or sliding of actin filaments past each other, mediated by motor proteins.
    GO:0016062    adaptation of rhodopsin mediated signaling    The process in which a rhodopsin-mediated signaling pathway is adjusted to modulate the sensitivity and response of a visual system to light stimuli (that might vary over more than 6 magnitudes in intensity) without response saturation.
    GO:0007099    centriole replication    The cell cycle process in which a daughter centriole is formed perpendicular to an existing centriole. An immature centriole contains a ninefold radially symmetric array of single microtubules; mature centrioles consist of a radial array of nine microtubule triplets, doublets, or singlets depending upon the species and cell type. Duplicated centrioles also become the ciliary basal body in cells that form cilia during G0.
    GO:0016059    deactivation of rhodopsin mediated signaling    The process of restoring the photoreceptor cell to its unexcited state after termination of the stimulus (photon).
    GO:0051383    kinetochore organization    A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of the kinetochore, a multisubunit complex that is located at the centromeric region of DNA and provides an attachment point for the spindle microtubules.
    GO:0046331    lateral inhibition    Signaling between cells of equivalent developmental potential that results in these cells adopting different developmental fates. An example is the suppression by cells with a particular fate of the adoption of the same fate by surrounding cells.
    GO:0016060    metarhodopsin inactivation    The process in which metarhodopsin is prevented from generating molecular signals. Activated rhodopsin (R*) is inactivated by a two-step process: first, R* is phosphorylated by rhodopsin kinase which lowers the activity of R*. Second, the protein arrestin binds to phosphorylated R* to de-activate it.
    GO:0090307    mitotic spindle assembly    The aggregation, arrangement and bonding together of a set of components to form the spindle that contributes to the process of mitosis.
    GO:0007052    mitotic spindle organization    A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of the microtubule spindle during a mitotic cell cycle.
    GO:0046716    muscle cell cellular homeostasis    The cellular homeostatic process that preserves a muscle cell in a stable functional or structural state.
    GO:0072499    photoreceptor cell axon guidance    The chemotaxis process that directs the migration of a photoreceptor cell axon growth cone to its target in the optic lobe in response to a combination of attractive and repulsive cues.
    GO:0051533    positive regulation of NFAT protein import into nucleus    Any process that activates or increases the frequency, rate or extent of the movement of an NFAT protein from the cytoplasm to the nucleus.
    GO:2001259    positive regulation of cation channel activity    Any process that activates or increases the frequency, rate or extent of cation channel activity.
    GO:0006468    protein phosphorylation    The process of introducing a phosphate group on to a protein.
    GO:0016061    regulation of light-activated channel activity    Any process that modulates the frequency, rate or extent of light-activated channel activity.
    GO:2001020    regulation of response to DNA damage stimulus    Any process that modulates the frequency, rate or extent of response to DNA damage stimulus.
    GO:0042052    rhabdomere development    The assembly and arrangement of a rhabdomere within a cell. The rhabdomere is the organelle on the apical surface of a photoreceptor cell that contains the visual pigments.
    GO:0016056    rhodopsin mediated signaling pathway    The series of molecular signals generated as a consequence of excitation of rhodopsin by a photon and the events that convert the absorbed photons into a cellular response.
    GO:0035071    salivary gland cell autophagic cell death    The stage-specific programmed cell death of salivary gland cells during salivary gland histolysis.
    GO:0007608    sensory perception of smell    The series of events required for an organism to receive an olfactory stimulus, convert it to a molecular signal, and recognize and characterize the signal. Olfaction involves the detection of chemical composition of an organism's ambient medium by chemoreceptors. This is a neurological process.
    GO:0007605    sensory perception of sound    The series of events required for an organism to receive an auditory stimulus, convert it to a molecular signal, and recognize and characterize the signal. Sonic stimuli are detected in the form of vibrations and are processed to form a sound.
cellular component
    GO:0005814    centriole    A cellular organelle, found close to the nucleus in many eukaryotic cells, consisting of a small cylinder with microtubular walls, 300-500 nm long and 150-250 nm in diameter. It contains nine short, parallel, peripheral microtubular fibrils, each fibril consisting of one complete microtubule fused to two incomplete microtubules. Cells usually have two centrioles, lying at right angles to each other. At division, each pair of centrioles generates another pair and the twin pairs form the pole of the mitotic spindle.
    GO:0005813    centrosome    A structure comprised of a core structure (in most organisms, a pair of centrioles) and peripheral material from which a microtubule-based structure, such as a spindle apparatus, is organized. Centrosomes occur close to the nucleus during interphase in many eukaryotic cells, though in animal cells it changes continually during the cell-division cycle.
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0005875    microtubule associated complex    Any multimeric complex connected to a microtubule.
    GO:0030496    midbody    A thin cytoplasmic bridge formed between daughter cells at the end of cytokinesis. The midbody forms where the contractile ring constricts, and may persist for some time before finally breaking to complete cytokinesis.
    GO:0031475    myosin V complex    A myosin complex containing a dimer of class V myosin heavy chains and associated light chains; involved in intracellular transport. Myosin V is a dimeric molecule consisting of conserved motor domains followed by 6 IQ motifs which bind specific light chains and calmodulin. The tail domain is important for cellular localization and cargo binding and can be divided into an alpha-helical coiled coil region and a C-terminal globular region.
    GO:0031476    myosin VI complex    A myosin complex containing one or more class VI myosin heavy chains and associated light chains. Myosin VI has a single IQ motif in the neck and a tail region with a coiled coil domain followed by a unique globular domain; a unique insertion that enables myosin VI to move towards the pointed or minus end of actin filaments.
    GO:0005654    nucleoplasm    That part of the nuclear content other than the chromosomes or the nucleolus.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
    GO:0016028    rhabdomere    The specialized microvilli-containing organelle on the apical surfaces of a photoreceptor cell containing the visual pigment rhodopsin and most of the proteins involved in phototransduction.
    GO:0005819    spindle    The array of microtubules and associated molecules that forms between opposite poles of a eukaryotic cell during mitosis or meiosis and serves to move the duplicated chromosomes apart.
    GO:0000922    spindle pole    Either of the ends of a spindle, where spindle microtubules are organized; usually contains a microtubule organizing center and accessory molecules, spindle microtubules and astral microtubules.

Chain B   (MYLK2_RABIT | P07313)
molecular function
    GO:0005524    ATP binding    Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
    GO:0005516    calmodulin binding    Interacting selectively and non-covalently with calmodulin, a calcium-binding protein with many roles, both in the calcium-bound and calcium-free states.
    GO:0004683    calmodulin-dependent protein kinase activity    Catalysis of the reactions: ATP + a protein serine = ADP + protein serine phosphate; and ATP + a protein threonine = ADP + protein threonine phosphate. These reactions require the presence of calcium-bound calmodulin.
    GO:0016301    kinase activity    Catalysis of the transfer of a phosphate group, usually from ATP, to a substrate molecule.
    GO:0004687    myosin light chain kinase activity    Catalysis of the reaction: ATP + myosin-light-chain = ADP + myosin-light-chain phosphate.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0004672    protein kinase activity    Catalysis of the phosphorylation of an amino acid residue in a protein, usually according to the reaction: a protein + ATP = a phosphoprotein + ADP.
    GO:0004674    protein serine/threonine kinase activity    Catalysis of the reactions: ATP + protein serine = ADP + protein serine phosphate, and ATP + protein threonine = ADP + protein threonine phosphate.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
    GO:0016310    phosphorylation    The process of introducing a phosphate group into a molecule, usually with the formation of a phosphoric ester, a phosphoric anhydride or a phosphoric amide.
    GO:0006468    protein phosphorylation    The process of introducing a phosphate group on to a protein.
    GO:0032971    regulation of muscle filament sliding    Any process that modulates the frequency, rate or extent of muscle filament sliding.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    CA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2bbm)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2bbm
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  CALM_DROME | P62152
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  MYLK2_RABIT | P07313
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  CALM_DROME | P62152
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  MYLK2_RABIT | P07313
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        CALM_DROME | P621521mxe 2bbn 2bkh 2vas 2x51 3gn4 3l9i 4anj 4cln 4dbp 4dbq 4pjj
        MYLK2_RABIT | P073132bbn

(-) Related Entries Specified in the PDB File

2bbn