Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit - manually
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit - manually
Asym./Biol. Unit - manually  (Jmol Viewer)
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  TYPE III ANTIFREEZE PROTEIN ISOFORM HPLC 12 N14Q
 
Authors :  S. P. Graether, C. I. Deluca, J. Baardsnes, G. A. Hill, P. L. Davies, Z. Jia
Date :  18 Jan 99  (Deposition) - 30 Apr 99  (Release) - 02 Mar 10  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.00
Chains :  Asym./Biol. Unit :  A
Keywords :  Antifreeze Protein, Mutant, Ice Binding Protein, Thermal Hysteresis Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  S. P. Graether, C. I. Deluca, J. Baardsnes, G. A. Hill, P. L. Davies, Z. Jia
Quantitative And Qualitative Analysis Of Type Iii Antifreeze Protein Structure And Function.
J. Biol. Chem. V. 274 11842 1999
PubMed-ID: 10207002  |  Reference-DOI: 10.1074/JBC.274.17.11842
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - PROTEIN (ANTIFREEZE PROTEIN TYPE III)
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPT7-7F
    Expression System Taxid562
    MutationYES
    Organism CommonOCEAN POUT
    Organism ScientificMACROZOARCES AMERICANUS
    Organism Taxid8199
    SynonymTYPE III ANTIFREEZE PROTEIN QAE ISOFORM

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2AME)

(-) Sites  (0, 0)

(no "Site" information available for 2AME)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2AME)

(-) Cis Peptide Bonds  (1, 1)

Asymmetric/Biological Unit
No.Residues
1Thr A:28 -Pro A:29

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2AME)

(-) PROSITE Motifs  (1, 1)

Asymmetric/Biological Unit (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1AFP_LIKEPS50844 Antifreeze protein-like domain profile.ANP12_ZOAAM4-63  1A:4-63

(-) Exons   (0, 0)

(no "Exon" information available for 2AME)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:66
 aligned with ANP12_ZOAAM | P19614 from UniProtKB/Swiss-Prot  Length:66

    Alignment length:66
                             1                                                                
                             |       9        19        29        39        49        59      
           ANP12_ZOAAM    - -NQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVKGYPP 65
               SCOP domains d2amea_ A: Type III antifreeze protein, AFP III                    SCOP domains
               CATH domains 2ameA00 A:0-65 Type Iii Antifreeze Protein Isoform Hplc 12         CATH domains
               Pfam domains ------------------------------------------------------------------ Pfam domains
         Sec.struct. author ....eeee...........hhheeee........hhhhhhh................hhh...... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ----AFP_LIKE  PDB: A:4-63 UniProt: 4-63                         -- PROSITE
                 Transcript ------------------------------------------------------------------ Transcript
                  2ame A  0 ANQASVVANQLIPIQTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVKGYAA 65
                                     9        19        29        39        49        59      

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

Asymmetric/Biological Unit

(-) CATH Domains  (1, 1)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2AME)

(-) Gene Ontology  (2, 2)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (ANP12_ZOAAM | P19614)
biological process
    GO:0050826    response to freezing    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a freezing stimulus, temperatures below 0 degrees Celsius.
cellular component
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2ame)
 
  Sites
(no "Sites" information available for 2ame)
 
  Cis Peptide Bonds
    Thr A:28 - Pro A:29   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2ame
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  ANP12_ZOAAM | P19614
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  ANP12_ZOAAM | P19614
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        ANP12_ZOAAM | P196141ame 1b7i 1b7j 1b7k 1ekl 1gzi 1hg7 1jab 1kde 1kdf 1msi 1msj 2jia 2msi 2msj 2spg 3ame 3msi 3qf6 4ame 4msi 4ny6 5c7r 5msi 6ame 6msi 7ame 7msi 8ame 8msi 9ame 9msi

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2AME)