Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  TYPE III ANTIFREEZE PROTEIN ISOFORM HPLC 12 N14SQ44T
 
Authors :  S. P. Graether, C. I. Deluca, J. Baardsnes, G. A. Hill, P. L. Davies, Z. Jia
Date :  24 Jan 99  (Deposition) - 29 Apr 99  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.60
Chains :  Asym./Biol. Unit :  A
Keywords :  Antifreeze Protein, Mutant, Ice Binding Protein, Thermal Hysteresis Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  S. P. Graether, C. I. Deluca, J. Baardsnes, G. A. Hill, P. L. Davies, Z. Jia
Quantitative And Qualitative Analysis Of Type Iii Antifreeze Protein Structure And Function.
J. Biol. Chem. V. 274 11842 1999
PubMed-ID: 10207002  |  Reference-DOI: 10.1074/JBC.274.17.11842
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - PROTEIN (ANTIFREEZE PROTEIN TYPE III)
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PT7-7F
    Expression System Taxid: 562
    Mutation: YES
    Organism Common: OCEAN POUT
    Organism Scientific: MACROZOARCES AMERICANUS
    Organism Taxid: 8199
    Synonym: TYPE III ANTIFREEZE PROTEIN QAE ISOFORM

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit : A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 8MSI)

(-) Sites  (0, 0)

(no "Site" information available for 8MSI)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 8MSI)

(-) Cis Peptide Bonds  (1, 1)

Asymmetric/Biological Unit
No.Residues
1Thr A:28 -Pro A:29

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 8MSI)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 8MSI)

(-) Exons   (0, 0)

(no "Exon" information available for 8MSI)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:66
                                                                                                 
               SCOP domains d8msia_ A: Type III antifreeze protein, AFP III                    SCOP domains
               CATH domains 8msiA00 A:0-65 Type Iii Antifreeze Protein Isoform Hplc 12         CATH domains
               Pfam domains ------------------------------------------------------------------ Pfam domains
         Sec.struct. author ....eeee...........hhheeee........hhhhhhh................hhh...... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------ Transcript
                  8msi A  0 ANQASVVANQLIPISTALTLVMMRSEVVTPVGIPAEDIPRLVSMTVNRAVPLGTTLMPDMVKGYAA 65
                                     9        19        29        39        49        59
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

Asymmetric/Biological Unit
(-)
Class: All beta proteins (24004)

(-) CATH Domains  (1, 1)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 8MSI)

(-) Gene Ontology  (2, 2)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 8msi)
 
  Sites
(no "Sites" information available for 8msi)
 
  Cis Peptide Bonds
    Thr A:28 - Pro A:29   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  8msi
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  ANP12_ZOAAM | P19614
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  ANP12_ZOAAM | P19614
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        ANP12_ZOAAM | P19614: 1ame 1b7i 1b7j 1b7k 1ekl 1gzi 1hg7 1jab 1kde 1kdf 1msi 1msj 2ame 2jia 2msi 2msj 2spg 3ame 3msi 3qf6 4ame 4msi 4ny6 5c7r 5msi 6ame 6msi 7ame 7msi 8ame 9ame 9msi

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 8MSI)