|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (2, 5)| Asymmetric Unit (2, 5) Biological Unit 1 (0, 0) |
Sites (3, 3)
Asymmetric Unit (3, 3)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 2AHZ) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2AHZ) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2AHZ) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2AHZ) |
Exons (0, 0)| (no "Exon" information available for 2AHZ) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:105 aligned with Q81HW2_BACCR | Q81HW2 from UniProtKB/TrEMBL Length:114 Alignment length:105 10 20 30 40 50 60 70 80 90 100 Q81HW2_BACCR 1 MLSFLLTLKRMLRACLRAWKDKEFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGDGNFSPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQLP 105 SCOP domains --------------------------------------------------------------------------------------------------------- SCOP domains CATH domains 2ahzA00 A:1-105 [code=1.10.287.70, no name defined] CATH domains Pfam domains --------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------------------------------------------------------- PROSITE Transcript --------------------------------------------------------------------------------------------------------- Transcript 2ahz A 1 MLSFLLTLKRMLRACLRAWKDKEFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGDGNFSPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQLP 105 10 20 30 40 50 60 70 80 90 100 Chain B from PDB Type:PROTEIN Length:103 aligned with Q81HW2_BACCR | Q81HW2 from UniProtKB/TrEMBL Length:114 Alignment length:103 10 20 30 40 50 60 70 80 90 100 Q81HW2_BACCR 1 MLSFLLTLKRMLRACLRAWKDKEFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGDGNFSPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQ 103 SCOP domains ------------------------------------------------------------------------------------------------------- SCOP domains CATH domains 2ahzB00 B:1-103 [code=1.10.287.70, no name defined] CATH domains Pfam domains ------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------------- PROSITE Transcript ------------------------------------------------------------------------------------------------------- Transcript 2ahz B 1 MLSFLLTLKRMLRACLRAWKDKEFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGDGNFSPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQ 103 10 20 30 40 50 60 70 80 90 100
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 2AHZ) |
CATH Domains (1, 2)| Asymmetric Unit |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2AHZ) |
Gene Ontology (2, 2)|
Asymmetric Unit(hide GO term definitions) Chain A,B (Q81HW2_BACCR | Q81HW2)
|
||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|