2ABT - JenaLib

Theor.Model - manually (Jmol Viewer)

Theoretical Model (Jmol Viewer)

Title :   HUMAN 15-LIPOXYGENASE

Authors :   P. Arul Prakasam, P. P. Mathur

Date :   16 Jul 05 (Deposition) - 02 Aug 05 (Release) - 02 Aug 05 (Revision)

Method :   THEORETICAL MODEL

Resolution :   NOT APPLICABLE

Chains :   Theor. Model : A

Keywords :   Human 12-Lipoxygenase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   P. Arul Prakasam, P. P. Mathur
Structure Of Human 15-Lipoxygenase
To Be Published
PubMed: search
(for further references see the PDB file header)

Molecule 1 - ARACHIDONATE 15-LIPOXYGENASE
	Chains	:	A
	EC Number	:	1.13.11.33
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Synonym	:	ARACHIDONATE OMEGA-6 LIPOXYGENASE, 15-LOX


Theoretical Model	:

Summary Information (see also Sequences/Alignments below)

Theoretical Model (1, 1)

No.	Name	Count	Type	Full Name
1	FE2	1	Ligand/Ion	FE (II) ION

(no "Site" information available for 2ABT)

(no "SS Bond" information available for 2ABT)

(no "Cis Peptide Bond" information available for 2ABT)

Theoretical Model (7, 7)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_018746	D	90	H	LOX15_HUMAN	Polymorphism	11568142	A	D	89	H
2	UniProt	VAR_035036	G	102	V	LOX15_HUMAN	Polymorphism	41439950	A	G	101	V
3	UniProt	VAR_018747	N	103	K	LOX15_HUMAN	Polymorphism	11568099	A	N	102	K
4	UniProt	VAR_018748	R	205	Q	LOX15_HUMAN	Polymorphism	11568101	A	R	204	Q
5	UniProt	VAR_035037	V	239	M	LOX15_HUMAN	Polymorphism	3892408	A	V	238	M
6	UniProt	VAR_035038	A	461	P	LOX15_HUMAN	Polymorphism	17852628	A	A	460	P
7	UniProt	VAR_035039	T	560	M	LOX15_HUMAN	Polymorphism	34210653	A	T	559	M

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Theoretical Model (4, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	PLAT	PS50095	PLAT domain profile.	LOX15_HUMAN	2-114	1	A:1-113
2	LIPOXYGENASE_3	PS51393	Lipoxygenase iron-binding catalytic domain profile.	LOX15_HUMAN	114-662	1	A:113-661
3	LIPOXYGENASE_1	PS00711	Lipoxygenases iron-binding region signature 1.	LOX15_HUMAN	355-369	1	A:354-368
4	LIPOXYGENASE_2	PS00081	Lipoxygenases iron-binding region signature 2.	LOX15_HUMAN	382-392	1	A:381-391

Theoretical Model (14, 14)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1	ENST00000293761	1	ENSE00001195427	chr17:4544958-4544812	147	LOX15_HUMAN	1-45	45	1	A:1-44	44
1.2	ENST00000293761	2	ENSE00001061272	chr17:4542926-4542725	202	LOX15_HUMAN	46-113	68	1	A:45-112	68
1.3	ENST00000293761	3	ENSE00001061268	chr17:4542427-4542346	82	LOX15_HUMAN	113-140	28	1	A:112-139	28
1.4	ENST00000293761	4	ENSE00001061271	chr17:4542267-4542145	123	LOX15_HUMAN	140-181	42	1	A:139-180	42
1.5	ENST00000293761	5	ENSE00001061269	chr17:4541979-4541876	104	LOX15_HUMAN	181-216	36	1	A:180-215	36
1.6	ENST00000293761	6	ENSE00001618216	chr17:4541672-4541512	161	LOX15_HUMAN	216-269	54	1	A:215-268	54
1.7	ENST00000293761	7	ENSE00001061261	chr17:4540553-4540410	144	LOX15_HUMAN	270-317	48	1	A:269-316	48
1.8	ENST00000293761	8	ENSE00001061262	chr17:4539263-4539054	210	LOX15_HUMAN	318-387	70	1	A:317-386	70
1.9	ENST00000293761	9	ENSE00001061264	chr17:4536795-4536709	87	LOX15_HUMAN	388-416	29	1	A:387-415	29
1.10	ENST00000293761	10	ENSE00001061267	chr17:4536610-4536441	170	LOX15_HUMAN	417-473	57	1	A:416-472	57
1.11	ENST00000293761	11	ENSE00001061270	chr17:4536277-4536156	122	LOX15_HUMAN	473-514	42	1	A:472-513	42
1.12	ENST00000293761	12	ENSE00001651707	chr17:4535576-4535476	101	LOX15_HUMAN	514-547	34	1	A:513-546	34
1.13	ENST00000293761	13	ENSE00001061266	chr17:4535351-4535184	168	LOX15_HUMAN	548-603	56	1	A:547-602	56
1.14	ENST00000293761	14	ENSE00001243007	chr17:4535074-4534214	861	LOX15_HUMAN	604-662	59	1	A:603-661	59

Theoretical Model

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:661
 aligned with LOX15_HUMAN | P16050 from UniProtKB/Swiss-Prot  Length:662

    Alignment length:661
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461       471       481       491       501       511       521       531       541       551       561       571       581       591       601       611       621       631       641       651       661 
          LOX15_HUMAN     2 GLYRIRVSTGASLYAGSNNQVQLWLVGQHGEAALGKRLWPARGKETELKVEVPEYLGPLLFVKLRKRHLLKDDAWFCNWISVQGPGAGDEVRFPCYRWVEGNGVLSLPEGTGRTVGEDPQGLFQKHREEELEERRKLYRWGNWKDGLILNMAGAKLYDLPVDERFLEDKRVDFEVSLAKGLADLAIKDSLNVLTCWKDLDDFNRIFWCGQSKLAERVRDSWKEDALFGYQFLNGANPVVLRRSAHLPARLVFPPGMEELQAQLEKELEGGTLFEADFSLLDGIKANVILCSQQHLAAPLVMLKLQPDGKLLPMVIQLQLPRTGSPPPPLFLPTDPPMAWLLAKCWVRSSDFQLHELQSHLLRGHLMAEVIVVATMRCLPSIHPIFKLIIPHLRYTLEINVRARTGLVSDMGIFDQIMSTGGGGHVQLLKQAGAFLTYSSFCPPDDLADRGLLGVKSSFYAQDALRLWEIIYRYVEGIVSLHYKTDVAVKDDPELQTWCREITEIGLQGAQDRGFPVSLQARDQVCHFVTMCIFTCTGQHASVHLGQLDWYSWVPNAPCTMRLPPPTTKDATLETVMATLPNFHQASLQMSITWQLGRRQPVMVAVGQHEEEYFSGPEPKAVLKKFREELAALDKEIEIRNAKLDMPYEYLRPSVVENSVAI 662
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeeee..........eeeeeeee...eeeeeeee......eeeeeee.......eeeeeeeee.......eeeeeeeee.......eeeeeeeee....eeeee..............hhhhhhhhhhhhhhhh.ee........ee...hhhhhhhhhh.hhhhhhhh........................hhhhhhhh.....hhhhhhhhhhh.hhhhhhhhhhhh......ee.............hhhhhhhhhhhhhhh.eeeee.hhhh.....ee..ee......eeeeee.....eeeeeee............ee....hhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhh.......hhhhhhh....hhhhhhhhhhhhhh.hhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhh....hhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhh..............hhhhhhhhh.hhhhhhhhhhhhhhh..hhhhh............hhhhhhhhhhhhhhhhhhhhhhhhhhhhh.................. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------H-----------VK-----------------------------------------------------------------------------------------------------Q---------------------------------M-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------P--------------------------------------------------------------------------------------------------M------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (1) PLAT  PDB: A:1-113 UniProt: 2-114                                                                                ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------LIPOXYGENASE_1 ------------LIPOXYGENAS------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (1)
                PROSITE (2) ----------------------------------------------------------------------------------------------------------------LIPOXYGENASE_3  PDB: A:113-661 UniProt: 114-662                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                       PROSITE (2)
           Transcript 1 (1) Exon 1.1  PDB: A:1-44 UniProt: 1-45         Exon 1.2  PDB: A:45-112 UniProt: 46-113                             --------------------------Exon 1.4  PDB: A:139-180 UniProt: 140-181 ----------------------------------Exon 1.6  PDB: A:215-268 UniProt: 216-269             Exon 1.7  PDB: A:269-316 UniProt: 270-317       Exon 1.8  PDB: A:317-386 UniProt: 318-387                             Exon 1.9  PDB: A:387-415     Exon 1.10  PDB: A:416-472 UniProt: 417-473               ----------------------------------------Exon 1.12  PDB: A:513-546         Exon 1.13  PDB: A:547-602 UniProt: 548-603              Exon 1.14  PDB: A:603-661 UniProt: 604-662                  Transcript 1 (1)
           Transcript 1 (2) ---------------------------------------------------------------------------------------------------------------Exon 1.3  PDB: A:112-139    ----------------------------------------Exon 1.5  PDB: A:180-215            ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Exon 1.11  PDB: A:472-513 UniProt: 473-514---------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1 (2)
                 2abt A   1 GLYRIRVSTGASLYAGSNNQVQLWLVGQHGEAALGKRLWPARGKETELKVEVPEYLGPLLFVKLRKRHLLKDDAWFCNWISVQGPGAGDEVRFPCYRWVEGNGVLSLPEGTGRTVGEDPQGLFQKHREEELEERRKLYRWGNWKDGLILNMAGAKLYDLPVDERFLEDKRVDFEVSLAKGLADLAIKDSLNVLTCWKDLDDFNRIFWCGQSKLAERVRDSWKEDALFGYQFLNGANPVVLRRSAHLPARLVFPPGMEELQAQLEKELEGGTLFEADFSLLDGIKANVILCSQQHLAAPLVMLKLQPDGKLLPMVIQLQLPRTGSPPPPLFLPTDPPMAWLLAKCWVRSSDFQLHELQSHLLRGHLMAEVIVVATMRCLPSIHPIFKLIIPHLRYTLEINVRARTGLVSDMGIFDQIMSTGGGGHVQLLKQAGAFLTYSSFCPPDDLADRGLLGVKSSFYAQDALRLWEIIYRYVEGIVSLHYKTDVAVKDDPELQTWCREITEIGLQGAQDRGFPVSLQARDQVCHFVTMCIFTCTGQHASVHLGQLDWYSWVPNAPCTMRLPPPTTKDATLETVMATLPNFHQASLQMSITWQLGRRQPVMVAVGQHEEEYFSGPEPKAVLKKFREELAALDKEIEIRNAKLDMPYEYLRPSVVENSVAI 661
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420       430       440       450       460       470       480       490       500       510       520       530       540       550       560       570       580       590       600       610       620       630       640       650       660

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

(no "SCOP Domain" information available for 2ABT)

(no "CATH Domain" information available for 2ABT)

(no "Pfam Domain" information available for 2ABT)

Theoretical Model(hide GO term definitions)

Chain A (LOX15_HUMAN | P16050)

molecular function
	GO:0004052	arachidonate 12-lipoxygenase activity	Catalysis of the reaction: arachidonate + O(2) = (5Z,8Z,10E,12S,14Z)-12-hydroperoxyicosa-5,8,10,14-tetraenoate.
	GO:0050473	arachidonate 15-lipoxygenase activity	Catalysis of the reaction: arachidonate + O2 = (5Z,8Z,11Z,13E)-(15S)-15-hydroperoxyicosa-5,8,11,13-tetraenoate.
	GO:0051213	dioxygenase activity	Catalysis of an oxidation-reduction (redox) reaction in which both atoms of oxygen from one molecule of O2 are incorporated into the (reduced) product(s) of the reaction. The two atoms of oxygen may be distributed between two different products.
	GO:0097260	eoxin A4 synthase activity	Catalysis of the reaction: leukotriene A4 = eoxin A4.
	GO:0051120	hepoxilin A3 synthase activity	Catalysis of the reaction: 12S-5Z,8Z,10E,14Z-12-hydro(pero)xy-eicosa-5,8,10,14-tetraenoic acid = (5Z,9E,14Z)-(8,11R,12S)-11,12-epoxy-8-hydroxyicosa-5,9,14-trienoate. 12S-5Z,8Z,10E,14Z-12-hydro(pero)xy-eicosa-5,8,10,14-tetraenoic acid is also known as 12S-HpETE, and (5Z,9E,14Z)-(8,11R,12S)-11,12-epoxy-8-hydroxyicosa-5,9,14-trienoate as hepoxilin A3.
	GO:0047977	hepoxilin-epoxide hydrolase activity	Catalysis of the reaction: (5Z,9E,14Z)-(8x,11R,12S)-11,12-epoxy-8-hydroxyicosa-5,9,14-trienoate + H2O = (5Z,9E,14Z)-(8x,11x,12S)-8,11,12-trihydroxyicosa-5,9,14-trienoate.
	GO:0005506	iron ion binding	Interacting selectively and non-covalently with iron (Fe) ions.
	GO:0008289	lipid binding	Interacting selectively and non-covalently with a lipid.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0016491	oxidoreductase activity	Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
	GO:0016702	oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen	Catalysis of an oxidation-reduction (redox) reaction in which hydrogen or electrons are transferred from one donor, and two oxygen atoms is incorporated into a donor.
	GO:0005546	phosphatidylinositol-4,5-bisphosphate binding	Interacting selectively and non-covalently with phosphatidylinositol-4,5-bisphosphate, a derivative of phosphatidylinositol in which the inositol ring is phosphorylated at the 4' and 5' positions.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0043277	apoptotic cell clearance	The recognition and removal of an apoptotic cell by a neighboring cell or by a phagocyte.
	GO:0019369	arachidonic acid metabolic process	The chemical reactions and pathways involving arachidonic acid, a straight chain fatty acid with 20 carbon atoms and four double bonds per molecule. Arachidonic acid is the all-Z-(5,8,11,14)-isomer.
	GO:0030282	bone mineralization	The deposition of hydroxyapatite, a form of calcium phosphate with the formula Ca10(PO4)6(OH)2, in bone tissue.
	GO:0071277	cellular response to calcium ion	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a calcium ion stimulus.
	GO:0035963	cellular response to interleukin-13	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an interleukin-13 stimulus.
	GO:0006631	fatty acid metabolic process	The chemical reactions and pathways involving fatty acids, aliphatic monocarboxylic acids liberated from naturally occurring fats and oils by hydrolysis.
	GO:0051122	hepoxilin biosynthetic process	The chemical reactions and pathways resulting in the formation of hepoxilins, a class of bioactive icosanoids with roles in the regulation of cell physiology.
	GO:0006954	inflammatory response	The immediate defensive reaction (by vertebrate tissue) to infection or injury caused by chemical or physical agents. The process is characterized by local vasodilation, extravasation of plasma into intercellular spaces and accumulation of white blood cells and macrophages.
	GO:0006691	leukotriene metabolic process	The chemical reactions and pathways involving leukotriene, a pharmacologically active substance derived from a polyunsaturated fatty acid, such as arachidonic acid.
	GO:0006629	lipid metabolic process	The chemical reactions and pathways involving lipids, compounds soluble in an organic solvent but not, or sparingly, in an aqueous solvent. Includes fatty acids; neutral fats, other fatty-acid esters, and soaps; long-chain (fatty) alcohols and waxes; sphingoids and other long-chain bases; glycolipids, phospholipids and sphingolipids; and carotenes, polyprenols, sterols, terpenes and other isoprenoids.
	GO:2001303	lipoxin A4 biosynthetic process	The chemical reactions and pathways resulting in the formation of lipoxin A4. Lipoxin A4 is a C20 hydroxy fatty acid having (5S)-, (6R)- and (15S)-hydroxy groups as well as (7E)- (9E)-, (11Z)- and (13E)-double bonds.
	GO:0019372	lipoxygenase pathway	The chemical reactions and pathways by which an unsaturated fatty acid (such as arachidonic acid or linolenic acid) is converted to other compounds, and in which the first step is hydroperoxide formation catalyzed by lipoxygenase.
	GO:0002820	negative regulation of adaptive immune response	Any process that stops, prevents, or reduces the frequency, rate, or extent of an adaptive immune response.
	GO:0001503	ossification	The formation of bone or of a bony substance, or the conversion of fibrous tissue or of cartilage into bone or a bony substance.
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
	GO:0006646	phosphatidylethanolamine biosynthetic process	The chemical reactions and pathways resulting in the formation of phosphatidylethanolamine, any of a class of glycerophospholipids in which a phosphatidyl group is esterified to the hydroxyl group of ethanolamine.
	GO:0070374	positive regulation of ERK1 and ERK2 cascade	Any process that activates or increases the frequency, rate or extent of signal transduction mediated by the ERK1 and ERK2 cascade.
	GO:0030838	positive regulation of actin filament polymerization	Any process that activates or increases the frequency, rate or extent of actin polymerization.
	GO:0010811	positive regulation of cell-substrate adhesion	Any process that increases the frequency, rate or extent of cell-substrate adhesion. Cell-substrate adhesion is the attachment of a cell to the underlying substrate via adhesion molecules.
	GO:0034116	positive regulation of heterotypic cell-cell adhesion	Any process that activates or increases the frequency, rate, or extent of heterotypic cell-cell adhesion.
	GO:1901074	regulation of engulfment of apoptotic cell	Any process that modulates the frequency, rate or extent of engulfment of apoptotic cell.
	GO:0035358	regulation of peroxisome proliferator activated receptor signaling pathway	Any process that modulates the frequency, rate or extent of the peroxisome proliferator activated receptor signaling pathway.
	GO:0034976	response to endoplasmic reticulum stress	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stress acting at the endoplasmic reticulum. ER stress usually results from the accumulation of unfolded or misfolded proteins in the ER lumen.
	GO:0042060	wound healing	The series of events that restore integrity to a damaged tissue, following an injury.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0031234	extrinsic component of cytoplasmic side of plasma membrane	The component of a plasma membrane consisting of gene products and protein complexes that are loosely bound to its cytoplasmic surface, but not integrated into the hydrophobic region.
	GO:0005811	lipid droplet	An intracellular non-membrane-bounded organelle comprising a matrix of coalesced lipids surrounded by a phospholipid monolayer. May include associated proteins.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Theoretical Model
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		FE2	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
(no "Sites" information available for 2abt)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2abt)

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Theoretical Model PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	2abt
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	LOX15_HUMAN \| P16050
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	1.13.11.33
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	LOX15_HUMAN \| P16050
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

(no "Entries Sharing at Least One Protein Chain" available for 2ABT)

2abu	HUMAN 12-LIPOXYGENASE
2abv	HUMAN 5-LIPOXYGENASE

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 1)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (7, 7)

PROSITE Motifs (4, 4)

Exons (14, 14)

Sequences/Alignments

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (43, 43)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File