2AAD - JenaLib

Title :   THE ROLE OF HISTIDINE-40 IN RIBONUCLEASE T1 CATALYSIS: THREE-DIMENSIONAL STRUCTURES OF THE PARTIALLY ACTIVE HIS40LYS MUTANT

Authors :   I. Zegers, P. Verhelst, C. W. Choe, J. Steyaert, U. Heinemann, L. Wyns, W. Saenger

Date :   15 Sep 92 (Deposition) - 31 Jan 94 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.00

Chains :   Asym. Unit : A,B
Biol. Unit 1: A  (1x)
Biol. Unit 2: B  (1x)

Keywords :   Hydrolase(Endoribonuclease) (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   I. Zegers, P. Verhelst, H. W. Choe, J. Steyaert, U. Heinemann, W. Saenger, L. Wyns
Role Of Histidine-40 In Ribonuclease T1 Catalysis: Three-Dimensionalstructures Of The Partially Active His40Lys Mutant.
Biochemistry V. 31 11317 1992
PubMed-ID: 1445870 | Reference-DOI: 10.1021/BI00161A009
(for further references see the PDB file header)

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (2, 4)

Sites (7, 7)

Asymmetric Unit (7, 7)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	ASP A:15 , HOH A:136 , HOH A:142 , HOH A:143 , HOH A:177 , HOH A:181	BINDING SITE FOR RESIDUE CA A 106
2	AC2	SOFTWARE	ASP B:15 , HOH B:122 , HOH B:137 , HOH B:216 , HOH B:217 , HOH B:218	BINDING SITE FOR RESIDUE CA B 107
3	AC3	SOFTWARE	TYR A:38 , LYS A:40 , LYS A:41 , TYR A:42 , ASN A:43 , ASN A:44 , TYR A:45 , GLU A:46 , GLU A:58 , ARG A:77 , HIS A:92 , ASN A:98 , PHE A:100 , HOH A:172 , HOH A:199	BINDING SITE FOR RESIDUE 2GP A 105
4	AC4	SOFTWARE	TYR B:38 , LYS B:40 , LYS B:41 , TYR B:42 , ASN B:43 , ASN B:44 , TYR B:45 , GLU B:46 , GLU B:58 , ARG B:77 , HIS B:92 , ASN B:98 , ASN B:99 , PHE B:100 , HOH B:139 , HOH B:142	BINDING SITE FOR RESIDUE 2GP B 105
5	BIN	UNKNOWN	TYR A:42 , ASN A:43 , ASN A:44 , TYR A:45 , GLU A:46 , ASN A:98 , TYR B:42 , ASN B:43 , ASN B:44 , TYR B:45 , GLU B:46 , ASN B:98	NULL
6	CAL	UNKNOWN	ASP A:15 , ASP B:15	NULL
7	CAT	UNKNOWN	TYR A:38 , LYS A:40 , GLU A:58 , ARG A:77 , HIS A:92 , TYR B:38 , LYS B:40 , GLU B:58 , ARG B:77 , HIS B:92	NULL

SS Bonds (4, 4)

Cis Peptide Bonds (4, 4)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:104
 aligned with RNT1_ASPOR | P00651 from UniProtKB/Swiss-Prot  Length:130

    Alignment length:104
                                    36        46        56        66        76        86        96       106       116       126    
           RNT1_ASPOR    27 ACDYTCGSNCYSSSDVSTAQAAGYQLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT 130
               SCOP domains d2aada_ A: RNase T1                                                                                      SCOP domains
               CATH domains 2aadA00 A:1-104  [code=3.10.450.30, no name defined]                                                     CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eee..eeeehhhhhhhhhhhhhhhhh.........eeee............eeeeeeee.............eeeeee...eeeeeee........eeee. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------- Transcript
                 2aad A   1 ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPKKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT 104
                                    10        20        30        40        50        60        70        80        90       100

Chain B from PDB  Type:PROTEIN  Length:104
 aligned with RNT1_ASPOR | P00651 from UniProtKB/Swiss-Prot  Length:130

    Alignment length:104
                                    36        46        56        66        76        86        96       106       116       126    
           RNT1_ASPOR    27 ACDYTCGSNCYSSSDVSTAQAAGYQLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT 130
               SCOP domains d2aadb_ B: RNase T1                                                                                      SCOP domains
               CATH domains 2aadB00 B:1-104  [code=3.10.450.30, no name defined]                                                     CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eee..eeeehhhhhhhhhhhhhhhhh.........eeee............eeeeeeee.............eeeeee...eeeeeee........eeee. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------- Transcript
                 2aad B   1 ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPKKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT 104
                                    10        20        30        40        50        60        70        80        90       100

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 2)

CATH Domains (1, 2)

Pfam Domains (0, 0)

Gene Ontology (13, 13)

Asymmetric Unit(hide GO term definitions)

Chain A,B (RNT1_ASPOR | P00651)

molecular function
	GO:0003723	RNA binding	Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
	GO:0004519	endonuclease activity	Catalysis of the hydrolysis of ester linkages within nucleic acids by creating internal breaks.
	GO:0004521	endoribonuclease activity	Catalysis of the hydrolysis of ester linkages within ribonucleic acid by creating internal breaks.
	GO:0016787	hydrolase activity	Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
	GO:0004518	nuclease activity	Catalysis of the hydrolysis of ester linkages within nucleic acids.
	GO:0046589	ribonuclease T1 activity	Catalysis of the endonucleolytic cleavage to nucleoside 3'-phosphates and 3'-phosphooligonucleotides ending in Gp with 2',3'-cyclic phosphate intermediates.
	GO:0004540	ribonuclease activity	Catalysis of the hydrolysis of phosphodiester bonds in chains of RNA.
biological process
	GO:0090501	RNA phosphodiester bond hydrolysis	The RNA metabolic process in which the phosphodiester bonds between ribonucleotides are cleaved by hydrolysis.
	GO:0090502	RNA phosphodiester bond hydrolysis, endonucleolytic	The chemical reactions and pathways involving the hydrolysis of internal 3',5'-phosphodiester bonds in one or two strands of ribonucleotides.
	GO:0008150	biological_process	Any process specifically pertinent to the functioning of integrated living units: cells, tissues, organs, and organisms. A process is a collection of molecular events with a defined beginning and end.
	GO:0090305	nucleic acid phosphodiester bond hydrolysis	The nucleic acid metabolic process in which the phosphodiester bonds between nucleotides are cleaved by hydrolysis.
cellular component
	GO:0030428	cell septum	A structure composed of peptidoglycan and often chitin in addition to other materials. It usually forms perpendicular to the long axis of a cell or hypha and grows centripetally from the cell wall to the center of the cell and often functions in the compartmentalization of a cell into two daughter cells.
	GO:0001411	hyphal tip	The end, or tip, of a fungal hypha, where polarized growth occurs during hyphal elongation.

Visualization

Interactive Views

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		2GP	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		CA	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		BIN	[ RasMol ]	+environment [ RasMol ]
		CAL	[ RasMol ]	+environment [ RasMol ]
		CAT	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Ser A:54 - Pro A:55	[ RasMol ]
		Ser B:54 - Pro B:55	[ RasMol ]
		Tyr A:38 - Pro A:39	[ RasMol ]
		Tyr B:38 - Pro B:39	[ RasMol ]

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	2aad
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	RNT1_ASPOR \| P00651
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	3.1.27.3
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Description