|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
(no "Ligand,Modified Residues,Ions" information available for 2A7T) |
(no "Site" information available for 2A7T) |
Asymmetric Unit
|
(no "Cis Peptide Bond" information available for 2A7T) |
(no "SAP(SNP)/Variant" information available for 2A7T) |
(no "PROSITE Motif" information available for 2A7T) |
(no "Exon" information available for 2A7T) |
Asymmetric UnitChain A from PDB Type:PROTEIN Length:64 aligned with SCX1_MESTA | P60277 from UniProtKB/Swiss-Prot Length:64 Alignment length:64 10 20 30 40 50 60 SCX1_MESTA 1 GEDGYIADGDNCTYICTFNNYCHALCTDKKGDSGACDWWVPYGVVCWCEDLPTPVPIRGSGKCR 64 SCOP domains d2a7ta_ A: Scorpion toxin SCOP domains CATH domains 2a7tA00 A:1-64 [code=3.30.30.10, no name defined] CATH domains Pfam domains ---------------------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------------- PROSITE Transcript ---------------------------------------------------------------- Transcript 2a7t A 1 GEDGYIADGDNCTYICTFNNYCHALCTDKKGDSGACDWWVPYGVVCWCEDLPTPVPIRGSGKCR 64 10 20 30 40 50 60 Chain B from PDB Type:PROTEIN Length:64 aligned with SCX1_MESTA | P60277 from UniProtKB/Swiss-Prot Length:64 Alignment length:64 10 20 30 40 50 60 SCX1_MESTA 1 GEDGYIADGDNCTYICTFNNYCHALCTDKKGDSGACDWWVPYGVVCWCEDLPTPVPIRGSGKCR 64 SCOP domains d2a7tb_ B: Scorpion toxin SCOP domains CATH domains 2a7tB00 B:1-64 [code=3.30.30.10, no name defined] CATH domains Pfam domains ---------------------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------------- PROSITE Transcript ---------------------------------------------------------------- Transcript 2a7t B 1 GEDGYIADGDNCTYICTFNNYCHALCTDKKGDSGACDWWVPYGVVCWCEDLPTPVPIRGSGKCR 64 10 20 30 40 50 60
|
Asymmetric Unit |
Asymmetric Unit |
(no "Pfam Domain" information available for 2A7T) |
Asymmetric Unit(hide GO term definitions) Chain A,B (SCX1_MESTA | P60277)
|
|
|
|
|
|
|