Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym.Unit - manually
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
collapse expand < >
Image Asym.Unit - manually
Asym.Unit - manually  (Jmol Viewer)
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  THREE-DIMENSIONAL STRUCTURE OF A NEUROTOXIN FROM RED SCORPION (BUTHUS TAMULUS) AT 2.2A RESOLUTION.
 
Authors :  M. Sharma, S. Yadav, S. Karthikeyan, S. Kumar, M. Paramasivam, A. Srinivasan, T. P. Singh
Date :  30 Dec 99  (Deposition) - 30 Dec 00  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.20
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Keywords :  Red Scorpion Neurotoxin (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  M. Sharma, S. Yadav, S. Karthikeyan, S. Kumar, M. Paramasivam, A. Srinivasan, T. P. Singh
Three-Dimensional Structure Of A Neurotoxin From Red Scorpion (Buthus Tamulus) At 2. 2A Resolution
To Be Published
PubMed: search
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - NEUROTOXIN
    ChainsA, B
    Organism CommonINDIAN RED SCORPION
    Organism ScientificMESOBUTHUS TAMULUS
    Organism Taxid34647
    SecretionVENOM

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit AB
Biological Unit 1 (1x)A 
Biological Unit 2 (1x) B

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1DQ7)

(-) Sites  (0, 0)

(no "Site" information available for 1DQ7)

(-) SS Bonds  (8, 8)

Asymmetric Unit
No.Residues
1A:12 -A:63
2A:16 -A:36
3A:22 -A:46
4A:26 -A:48
5B:12 -B:63
6B:16 -B:36
7B:22 -B:46
8B:26 -B:48

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1DQ7)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1DQ7)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1DQ7)

(-) Exons   (0, 0)

(no "Exon" information available for 1DQ7)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:64
 aligned with SCX1_MESTA | P60277 from UniProtKB/Swiss-Prot  Length:64

    Alignment length:64
                                    10        20        30        40        50        60    
            SCX1_MESTA    1 GEDGYIADGDNCTYICTFNNYCHALCTDKKGDSGACDWWVPYGVVCWCEDLPTPVPIRGSGKCR 64
               SCOP domains d1dq7a_ A: Scorpion toxin                                        SCOP domains
               CATH domains 1dq7A00 A:1-64  [code=3.30.30.10, no name defined]               CATH domains
               Pfam domains ---------------------------------------------------------------- Pfam domains
         Sec.struct. author .eee.............hhhhhhhhhhhh...eeeeeeee..eeeeeeeee............. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------- Transcript
                  1dq7 A  1 GEDGYIADGDNCTYICTFNNYCHALCTDKKGDSGACDWWVPYGVVCWCEDLPTPVPIRGSGKCR 64
                                    10        20        30        40        50        60    

Chain B from PDB  Type:PROTEIN  Length:64
 aligned with SCX1_MESTA | P60277 from UniProtKB/Swiss-Prot  Length:64

    Alignment length:64
                                    10        20        30        40        50        60    
            SCX1_MESTA    1 GEDGYIADGDNCTYICTFNNYCHALCTDKKGDSGACDWWVPYGVVCWCEDLPTPVPIRGSGKCR 64
               SCOP domains d1dq7b_ B: Scorpion toxin                                        SCOP domains
               CATH domains 1dq7B00 B:1-64  [code=3.30.30.10, no name defined]               CATH domains
               Pfam domains ---------------------------------------------------------------- Pfam domains
         Sec.struct. author .eee.............hhhhhhhhhhh....eeeeeeee..eeeeeeeee............. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------- Transcript
                  1dq7 B  1 GEDGYIADGDNCTYICTFNNYCHALCTDKKGDSGACDWWVPYGVVCWCEDLPTPVPIRGSGKCR 64
                                    10        20        30        40        50        60    

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric Unit

(-) CATH Domains  (1, 2)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1DQ7)

(-) Gene Ontology  (3, 3)

Asymmetric Unit(hide GO term definitions)
Chain A,B   (SCX1_MESTA | P60277)
molecular function
    GO:0008200    ion channel inhibitor activity    Stops, prevents, or reduces the activity of an ion channel.
biological process
    GO:0006952    defense response    Reactions, triggered in response to the presence of a foreign body or the occurrence of an injury, which result in restriction of damage to the organism attacked or prevention/recovery from the infection caused by the attack.
cellular component
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1dq7)
 
  Sites
(no "Sites" information available for 1dq7)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1dq7)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1dq7
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  SCX1_MESTA | P60277
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  SCX1_MESTA | P60277
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        SCX1_MESTA | P602772a7t

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1DQ7)