|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 2A5M) |
Sites (0, 0)| (no "Site" information available for 2A5M) |
SS Bonds (0, 0)| (no "SS Bond" information available for 2A5M) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2A5M) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2A5M) |
PROSITE Motifs (1, 4)
NMR Structure (1, 4)
|
||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 2A5M) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:177 aligned with CRBS_MOUSE | O35486 from UniProtKB/Swiss-Prot Length:178 Alignment length:177 11 21 31 41 51 61 71 81 91 101 111 121 131 141 151 161 171 CRBS_MOUSE 2 SKTGGKISFYEDRNFQGRRYDCDCDCADFRSYLSRCNSIRVEGGTWAVYERPNFSGHMYILPQGEYPEYQRWMGLNDRLGSCRAVHLSSGGQAKIQVFEKGDFNGQMYETTEDCPSIMEQFHLREIHSCKVVEGTWIFYELPNYRGRQYLLDKKEYRKPVDWGAASPAIQSFRRIVE 178 SCOP domains d2a5ma1 A:1-90 gamma-Crystallin d2a5ma2 A:91-177 gamma-Crystallin SCOP domains CATH domains 2a5mA01 A:1-87 Crystallins 2a5mA02 A:88-177 Crystallins CATH domains Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ----CRYSTALLIN_BETA_GAMMA PDB: A:5-43 CRYSTALLIN_BETA_GAMMA PDB: A:44-86 ------CRYSTALLIN_BETA_GAMMA PDB: A:93-133 CRYSTALLIN_BETA_GAMMA PDB: A:134-176 - PROSITE Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 2a5m A 1 SKTGGKISFYEDRNFQGRRYDCDCDCADFRSYLSRCNSIRVEGGTWAVYERPNFSGHMYILPQGEYPEYQRWMGLNDRLGSCRAVHLSSGGQAKIQVFEKGDFNGQMYETTEDCPSIMEQFHLREIHSCKVVEGTWIFYELPNYRGRQYLLDKKEYRKPVDWGAASPAIQSFRRIVE 177 10 20 30 40 50 60 70 80 90 100 110 120 130 140 150 160 170
|
||||||||||||||||||||
SCOP Domains (1, 2)| NMR Structure |
CATH Domains (1, 2)| NMR Structure |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2A5M) |
Gene Ontology (3, 3)|
NMR Structure(hide GO term definitions) Chain A (CRBS_MOUSE | O35486)
|
||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|