Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  NMR STRUCTURE OF MURINE GAMMA-S CRYSTALLIN
 
Authors :  Z. Wu, F. Delaglio, K. Wyatt, G. Wistow, A. Bax
Date :  03 Jun 05  (Deposition) - 05 Jul 05  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (20x)
Keywords :  Alignment, Deuteration, Liquid Crystal, Pf1, Relaxation, Rdc, Residual Dipolar Coupling, Molecular Fragment Replacement, Mfr, Structural Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  Z. Wu, F. Delaglio, K. Wyatt, G. Wistow, A. Bax
Solution Structure Of (Gamma)S-Crystallin By Molecular Fragment Replacement Nmr.
Protein Sci. V. 14 3101 2005
PubMed-ID: 16260758  |  Reference-DOI: 10.1110/PS.051635205
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - GAMMA CRYSTALLIN S
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI BL21
    Expression System Strain: BL21
    Expression System Taxid: 511693
    Gene: CRYGS
    Organism Common: HOUSE MOUSE
    Organism Scientific: MUS MUSCULUS
    Organism Taxid: 10090
    Synonym: GAMMA CRYSTALLIN S

 Structural Features

(-) Chains, Units

  
NMR Structure (20x): 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1ZWM)

(-) Sites  (0, 0)

(no "Site" information available for 1ZWM)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1ZWM)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1ZWM)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1ZWM)

(-) PROSITE Motifs  (1, 4)

NMR Structure (1, 4)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1CRYSTALLIN_BETA_GAMMAPS50915 Crystallins beta and gamma 'Greek key' motif profile.CRBS_MOUSE6-44
45-87
94-134
135-177		  4A:5-43
A:44-86
A:93-133
A:134-176

(-) Exons   (0, 0)

(no "Exon" information available for 1ZWM)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:177
 aligned with CRBS_MOUSE | O35486 from UniProtKB/Swiss-Prot  Length:178

    Alignment length:177
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       
           CRBS_MOUSE     2 SKTGGKISFYEDRNFQGRRYDCDCDCADFRSYLSRCNSIRVEGGTWAVYERPNFSGHMYILPQGEYPEYQRWMGLNDRLGSCRAVHLSSGGQAKIQVFEKGDFNGQMYETTEDCPSIMEQFHLREIHSCKVVEGTWIFYELPNYRGRQYLLDKKEYRKPVDWGAASPAIQSFRRIVE 178
               SCOP domains d1zwma1 A:1-90 gamma-Crystallin                                                           d1zwma2 A:91-177 gamma-Crystallin                                                       SCOP domains
               CATH domains 1zwmA01 A:1-87 Crystallins                                                             1zwmA02 A:88-177 Crystallins                                                               CATH domains
           Pfam domains (1) ---------------------------------------------------------------------------------------------Crystall-1zwmA01 A:94-175                                                         -- Pfam domains (1)
           Pfam domains (2) ---------------------------------------------------------------------------------------------Crystall-1zwmA02 A:94-175                                                         -- Pfam domains (2)
         Sec.struct. author .....eeeee........eeee...............eeeeee.eeeeeee...eeeeeee..eee.hhhhhh.......eeeee.........eeeeee...eeeeeee.....hhhhhhh.....eeee....eeeeee...eeeeeee......hhhhhh.......eeee... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----CRYSTALLIN_BETA_GAMMA  PDB: A:5-43     CRYSTALLIN_BETA_GAMMA  PDB: A:44-86        ------CRYSTALLIN_BETA_GAMMA  PDB: A:93-133     CRYSTALLIN_BETA_GAMMA  PDB: A:134-176      - PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1zwm A   1 SKTGGKISFYEDRNFQGRRYDCDCDCADFRSYLSRCNSIRVEGGTWAVYERPNFSGHMYILPQGEYPEYQRWMGLNDRLGSCRAVHLSSGGQAKIQVFEKGDFNGQMYETTEDCPSIMEQFHLREIHSCKVVEGTWIFYELPNYRGRQYLLDKKEYRKPVDWGAASPAIQSFRRIVE 177
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

NMR Structure
(-)
Class: All beta proteins (24004)

(-) CATH Domains  (1, 2)

NMR Structure
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (1, 2)

NMR Structure
(-)
Clan: gCrystallin (22)

(-) Gene Ontology  (3, 3)

NMR Structure(hide GO term definitions)
Chain A   (CRBS_MOUSE | O35486)
molecular function
    GO:0005212    structural constituent of eye lens    The action of a molecule that contributes to the structural integrity of the lens of an eye.
biological process
    GO:0002088    lens development in camera-type eye    The process whose specific outcome is the progression of the lens over time, from its formation to the mature structure. The lens is a transparent structure in the eye through which light is focused onto the retina. An example of this process is found in Mus musculus.
    GO:0002009    morphogenesis of an epithelium    The process in which the anatomical structures of epithelia are generated and organized. An epithelium consists of closely packed cells arranged in one or more layers, that covers the outer surfaces of the body or lines any internal cavity or tube.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1zwm)
 
  Sites
(no "Sites" information available for 1zwm)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1zwm)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ NMR Structure - model 1 PNG format | NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1zwm
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  CRBS_MOUSE | O35486
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  CRBS_MOUSE | O35486
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        CRBS_MOUSE | O35486: 1zwo 2a5m

(-) Related Entries Specified in the PDB File

1a45 1a5d 1a7h 1ag4 1amm 1hk0 1zwo