Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym.Unit - manually
(-)Asymmetric Unit
(-)Biological Unit 1
collapse expand < >
Image Asym.Unit - manually
Asym.Unit - manually  (Jmol Viewer)
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF KLEBSIELLA PNEUMONIAE PROTEIN ORFY, PFAM DUF336
 
Authors :  U. Ramagopal, Y. Patskovsky, S. C. Almo, S. K. Burley, New York Sgx Re Center For Structural Genomics (Nysgxrc)
Date :  22 Jun 05  (Deposition) - 28 Jun 05  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.20
Chains :  Asym. Unit :  A,B,C,D
Biol. Unit 1:  A,B,C,D  (2x)
Keywords :  Unknown, Structural Genomics, Psi, Protein Structure Initiative, New York Sgx Research Center For Structural Genomics, Nysgxrc, Unknown Function (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  U. Ramagopal, Y. Patskovsky, S. C. Almo
Crystal Structure Of Klebsiella Pneumoniae Hypothetical Protein Orfy
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - UNKNOWN
    Atcc: 25955
    Chains: A, B, C, D
    Engineered: YES
    Expression System: ESCHERICHIA COLI BL21
    Expression System Plasmid: PET
    Expression System Strain: BL21
    Expression System Taxid: 511693
    Expression System Vector Type: PLASMID
    Gene: ORFY
    Organism Scientific: KLEBSIELLA PNEUMONIAE
    Organism Taxid: 573

 Structural Features

(-) Chains, Units

  1234
Asymmetric Unit : ABCD
Biological Unit 1 (2x): ABCD

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2A2L)

(-) Sites  (0, 0)

(no "Site" information available for 2A2L)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2A2L)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2A2L)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2A2L)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2A2L)

(-) Exons   (0, 0)

(no "Exon" information available for 2A2L)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:145
 aligned with Q48422_KLEPN | Q48422 from UniProtKB/TrEMBL  Length:143

    Alignment length:145
                             1                                                                                                                                           143 
                             |       9        19        29        39        49        59        69        79        89        99       109       119       129       139   | 
         Q48422_KLEPN     - -MMNKSQQVQTITLAAAQQMAAAVEKKATEINVAVVFSVVDRGGNTLLIQRMDEAFVSSCDISLNKAWSACSLKQGTHEITSAVQPGQSLYGLQLTNQQRIIIFGGGLPVIFNEQVIGAVGVSGGTVEQDQLLAQCALDCFSAL-   -
               SCOP domains --d2a2la1 A:4-145 DhaI homolog                                                                                                                  - SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....eeeeeeehhhhhhhhhhhhhhhhhhh....eeeeee....eeeeee......hhhhhhhhhhhhhhhh..hhhhhhhhh.......hhhhhhhhh......eeeee....eeeeeeee..hhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2a2l A   2 SLMNKSQQVQTITLAAAQQMAAAVEKKATEINVAVVFSVVDRGGNTLLIQRMDEAFVSSCDISLNKAWSACSLKQGTHEITSAVQPGQSLYGLQLTNQQRIIIFGGGLPVIFNEQVIGAVGVSGGTVEQDQLLAQCALDCFSALE 146
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141     


Chain B from PDB  Type:PROTEIN  Length:145
 aligned with Q48422_KLEPN | Q48422 from UniProtKB/TrEMBL  Length:143

    Alignment length:145
                             1                                                                                                                                           143 
                             |       9        19        29        39        49        59        69        79        89        99       109       119       129       139   | 
         Q48422_KLEPN     - -MMNKSQQVQTITLAAAQQMAAAVEKKATEINVAVVFSVVDRGGNTLLIQRMDEAFVSSCDISLNKAWSACSLKQGTHEITSAVQPGQSLYGLQLTNQQRIIIFGGGLPVIFNEQVIGAVGVSGGTVEQDQLLAQCALDCFSAL-   -
               SCOP domains d2a2lb_ B: DhaI homolog                                                                                                                           SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....eeeeeeehhhhhhhhhhhhhhhhhhhh...eeeee.....eeeeee......hhhhhhhhhhhhhhhhh.hhhhhhhhhh......hhhhhhhhh......eeeeee..eeeeeeeee..hhhhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2a2l B   2 SLMNKSQQVQTITLAAAQQMAAAVEKKATEINVAVVFSVVDRGGNTLLIQRMDEAFVSSCDISLNKAWSACSLKQGTHEITSAVQPGQSLYGLQLTNQQRIIIFGGGLPVIFNEQVIGAVGVSGGTVEQDQLLAQCALDCFSALE 146
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141     


Chain C from PDB  Type:PROTEIN  Length:143
 aligned with Q48422_KLEPN | Q48422 from UniProtKB/TrEMBL  Length:143

    Alignment length:143
                                                                                                                                                                       143 
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141 | 
         Q48422_KLEPN     2 MNKSQQVQTITLAAAQQMAAAVEKKATEINVAVVFSVVDRGGNTLLIQRMDEAFVSSCDISLNKAWSACSLKQGTHEITSAVQPGQSLYGLQLTNQQRIIIFGGGLPVIFNEQVIGAVGVSGGTVEQDQLLAQCALDCFSAL-   -
               SCOP domains d2a2lc_ C: DhaI homolog                                                                                                                         SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeeeeehhhhhhhhhhhhhhhhhhh....eeeee.....eeeeee......hhhhhhhhhhhhhhhh..hhhhhh.............hhhhhh......eeeeee..eeeeeeeee..hhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2a2l C   4 MNKSQQVQTITLAAAQQMAAAVEKKATEINVAVVFSVVDRGGNTLLIQRMDEAFVSSCDISLNKAWSACSLKQGTHEITSAVQPGQSLYGLQLTNQQRIIIFGGGLPVIFNEQVIGAVGVSGGTVEQDQLLAQCALDCFSALE 146
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143   


Chain D from PDB  Type:PROTEIN  Length:143
 aligned with Q48422_KLEPN | Q48422 from UniProtKB/TrEMBL  Length:143

    Alignment length:143
                                                                                                                                                                       143 
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141 | 
         Q48422_KLEPN     2 MNKSQQVQTITLAAAQQMAAAVEKKATEINVAVVFSVVDRGGNTLLIQRMDEAFVSSCDISLNKAWSACSLKQGTHEITSAVQPGQSLYGLQLTNQQRIIIFGGGLPVIFNEQVIGAVGVSGGTVEQDQLLAQCALDCFSAL-   -
               SCOP domains d2a2ld_ D: DhaI homolog                                                                                                                         SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeeeeehhhhhhhhhhhhhhhhhhh....eeeee.....eeeeee......hhhhhhhhhhhhhhhhh.hhhhhhhhhh......hhhhhhhhh......eeeeee..eeeeeeeee..hhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2a2l D   4 MNKSQQVQTITLAAAQQMAAAVEKKATEINVAVVFSVVDRGGNTLLIQRMDEAFVSSCDISLNKAWSACSLKQGTHEITSAVQPGQSLYGLQLTNQQRIIIFGGGLPVIFNEQVIGAVGVSGGTVEQDQLLAQCALDCFSALE 146
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 4)

Asymmetric Unit
(-)
Class: Alpha and beta proteins (a+b) (23004)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2A2L)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2A2L)

(-) Gene Ontology  (0, 0)

Asymmetric Unit(hide GO term definitions)
    (no "Gene Ontology" information available for 2A2L)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2a2l)
 
  Sites
(no "Sites" information available for 2a2l)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2a2l)
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Biol. Unit 1 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2a2l
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q48422_KLEPN | Q48422
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q48422_KLEPN | Q48422
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2A2L)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2A2L)