1ZUD - JenaLib

Asym.Unit - manually (Jmol Viewer)

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Biological Unit 3 (Jmol Viewer)

Title :   STRUCTURE OF THIS-THIF PROTEIN COMPLEX

Authors :   S. E. Ealick, C. Lehmann

Date :   30 May 05 (Deposition) - 31 Jan 06 (Release) - 13 Jul 11 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.98

Chains :   Asym. Unit : 1,2,3,4
Biol. Unit 1: 1,2,3,4  (1x)
Biol. Unit 2: 3,4  (1x)
Biol. Unit 3: 1,2  (1x)

Keywords :   Thiamin, Thiazole, Protein-Protein Complex, This, Thif, Transferase- Biosynthetic Protein Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   C. Lehmann, T. P. Begley, S. E. Ealick
Structure Of The Escherichia Coli This-Thif Complex, A Key Component Of The Sulfur Transfer System In Thiamin Biosynthesis.
Biochemistry V. 45 11 2006
PubMed-ID: 16388576 | Reference-DOI: 10.1021/BI051502Y

Molecule 1 - ADENYLYLTRANSFERASE THIF
	Chains	:	1, 3
	EC Number	:	2.7.7.-
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PET22B
	Expression System Taxid	:	562
	Expression System Vector Type	:	PLASMID
	Organism Scientific	:	ESCHERICHIA COLI
	Organism Taxid	:	83333
	Strain	:	K12

Molecule 2 - THIS PROTEIN
	Chains	:	2, 4
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PET22B
	Expression System Taxid	:	562
	Expression System Vector Type	:	PLASMID
	Organism Scientific	:	ESCHERICHIA COLI
	Organism Taxid	:	83333
	Strain	:	K12

		1	2	3	4
Asymmetric Unit	:	1	2	3	4
Biological Unit 1 (1x)	:	1	2	3	4
Biological Unit 2 (1x)	:			3	4
Biological Unit 3 (1x)	:	1	2

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (3, 6)

No.	Name	Count	Type	Full Name
1	CA	2	Ligand/Ion	CALCIUM ION
2	NA	2	Ligand/Ion	SODIUM ION
3	ZN	2	Ligand/Ion	ZINC ION

Biological Unit 1 (0, 0)

No.	Name	Count	Type	Full Name
1	CA	-1	Ligand/Ion	CALCIUM ION
2	NA	-1	Ligand/Ion	SODIUM ION
3	ZN	-1	Ligand/Ion	ZINC ION

Biological Unit 2 (0, 0)

No.	Name	Count	Type	Full Name
1	CA	-1	Ligand/Ion	CALCIUM ION
2	NA	-1	Ligand/Ion	SODIUM ION
3	ZN	-1	Ligand/Ion	ZINC ION

Biological Unit 3 (0, 0)

No.	Name	Count	Type	Full Name
1	CA	-1	Ligand/Ion	CALCIUM ION
2	NA	-1	Ligand/Ion	SODIUM ION
3	ZN	-1	Ligand/Ion	ZINC ION

Asymmetric Unit (6, 6)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	CYS 1:169 , CYS 1:172 , CYS 1:240 , CYS 1:243	BINDING SITE FOR RESIDUE ZN 1 501
2	AC2	SOFTWARE	CYS 3:169 , CYS 3:172 , CYS 3:240 , CYS 3:243	BINDING SITE FOR RESIDUE ZN 3 502
3	AC3	SOFTWARE	LEU 1:14 , ASP 1:16 , HOH 1:704 , LEU 3:14 , ASP 3:16 , HOH 3:764	BINDING SITE FOR RESIDUE CA 3 601
4	AC4	SOFTWARE	CYS 1:243 , HOH 1:800 , HOH 1:801 , HOH 1:802 , HOH 3:772 , HOH 3:809 , HOH 3:810	BINDING SITE FOR RESIDUE CA 1 602
5	AC5	SOFTWARE	VAL 1:116 , ALA 1:117 , ALA 1:119 , THR 1:144 , HOH 1:755 , HOH 1:757	BINDING SITE FOR RESIDUE NA 1 701
6	AC6	SOFTWARE	VAL 3:116 , ALA 3:117 , ALA 3:119 , THR 3:144 , HOH 3:796 , HOH 3:808	BINDING SITE FOR RESIDUE NA 3 702

(no "SS Bond" information available for 1ZUD)

Asymmetric Unit

No.	Residues
1	Pro 1:163	-	Pro 1:164
2	Pro 3:163	-	Pro 3:164

(no "SAP(SNP)/Variant" information available for 1ZUD)

(no "PROSITE Motif" information available for 1ZUD)

(no "Exon" information available for 1ZUD)

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain 1 from PDB  Type:PROTEIN  Length:234
 aligned with THIF_ECOLI | P30138 from UniProtKB/Swiss-Prot  Length:251

    Alignment length:245
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240     
           THIF_ECOLI     1 MNDRDFMRYSRQILLDDIALDGQQKLLDSQVLIIGLGGLGTPAALYLAGAGVGTLVLADDDDVHLSNLQRQILFTTEDIDRPKSQVSQQRLTQLNPDIQLTALQQRLTGEALKDAVARADVVLDCTDNMATRQEINAACVALNTPLITASAVGFGGQLMVLTPPWEQGCYRCLWPDNQEPERNCRTAGVVGPVVGVMGTLQALEAIKLLSGIETPAGELRLFDGKSSQWRSLALRRASGCPVCGG 245
               SCOP domains d1zud1_ 1: automated matches                                                                                                                                                                                                                          SCOP domains
               CATH domains 1zud100 1:1-245 NAD(P)-binding Rossmann-like Domain                                                                                                                                                                                                   CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhh...hhhhhhhhhhh.eeeee....hhhhhhhhhhhh...eeeee.....hhhhh......hhhhh..hhhhhhhhhhhhhh...eeeee....hhhhhhhhhhhh.eeee...hhhhhhhhhhhhhhh...eeeeeee..eeeeeee.......hhhhhh.-----------...hhhhhhhhhhhhhhhhhhhhhh......eeeeee....eeeeee............ Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1zud 1   1 MNDRDFMRYSRQILLDDIALDGQQKLLDSQVLIIGLGGLGTPAALYLAGAGVGTLVLADDDDVHLSNLQRQILFTTEDIDRPKSQVSQQRLTQLNPDIQLTALQQRLTGEALKDAVARADVVLDCTDNMATRQEINAACVALNTPLITASAVGFGGQLMVLTPPWEQGCYRCLWP-----------AGVVGPVVGVMGTLQALEAIKLLSGIETPAGELRLFDGKSSQWRSLALRRASGCPVCGG 245
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170    |    -      |190       200       210       220       230       240     
                                                                                                                                                                                                        175         187

Chain 2 from PDB  Type:PROTEIN  Length:65
 aligned with THIS_ECOLI | O32583 from UniProtKB/Swiss-Prot  Length:66

    Alignment length:65
                                    11        21        31        41        51        61     
           THIS_ECOLI     2 QILFNDQAMQCAAGQTVHELLEQLDQRQAGAALAINQQIVPREQWAQHIVQDGDQILLFQVIAGG  66
               SCOP domains d1zud2_ 2: Thiamin biosynthesis sulfur carrier protein ThiS       SCOP domains
               CATH domains 1zud200 2:2-66  [code=3.10.20.30, no name defined]                CATH domains
               Pfam domains ----------------------------------------------------------------- Pfam domains
         Sec.struct. author .eee..eee......hhhhhhhhhh.....eeeee..ee.hhhhh.........eeeeee..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------- Transcript
                 1zud 2   2 QILFNDQAMQCAAGQTVHELLEQLDQRQAGAALAINQQIVPREQWAQHIVQDGDQILLFQVIAGG  66
                                    11        21        31        41        51        61

Chain 3 from PDB  Type:PROTEIN  Length:240
 aligned with THIF_ECOLI | P30138 from UniProtKB/Swiss-Prot  Length:251

    Alignment length:245
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240     
           THIF_ECOLI     1 MNDRDFMRYSRQILLDDIALDGQQKLLDSQVLIIGLGGLGTPAALYLAGAGVGTLVLADDDDVHLSNLQRQILFTTEDIDRPKSQVSQQRLTQLNPDIQLTALQQRLTGEALKDAVARADVVLDCTDNMATRQEINAACVALNTPLITASAVGFGGQLMVLTPPWEQGCYRCLWPDNQEPERNCRTAGVVGPVVGVMGTLQALEAIKLLSGIETPAGELRLFDGKSSQWRSLALRRASGCPVCGG 245
               SCOP domains d1zud3_ 3: automated matches                                                                                                                                                                                                                          SCOP domains
               CATH domains 1zud300 3:1-245 NAD(P)-binding Rossmann-like Domain                                                                                                                                                                                                   CATH domains
           Pfam domains (1) --------------------------ThiF-1zud301 3:27-161                                                                                                                  ----MoeZ_MoeB-1zud3     03 3:166-245                                                 Pfam domains (1)
           Pfam domains (2) --------------------------ThiF-1zud302 3:27-161                                                                                                                  ----MoeZ_MoeB-1zud3     04 3:166-245                                                 Pfam domains (2)
         Sec.struct. author .hhhhhhhhhhhhh...hhhhhhhhhhh.eeeee....hhhhhhhhhhhhh..eeeee.....hhhhh......hhhhh..hhhhhhhhhhhhhh...eeeee....hhhhhhhhhhhh.eeee...hhhhhhhhhhhhhhh...eeeeeee..eeeeeee.......hhhhhh......-----....hhhhhhhhhhhhhhhhhhhhhh......eeeeee....eeeeee............ Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1zud 3   1 MNDRDFMRYSRQILLDDIALDGQQKLLDSQVLIIGLGGLGTPAALYLAGAGVGTLVLADDDDVHLSNLQRQILFTTEDIDRPKSQVSQQRLTQLNPDIQLTALQQRLTGEALKDAVARADVVLDCTDNMATRQEINAACVALNTPLITASAVGFGGQLMVLTPPWEQGCYRCLWPDNQEP-----TAGVVGPVVGVMGTLQALEAIKLLSGIETPAGELRLFDGKSSQWRSLALRRASGCPVCGG 245
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180     | 190       200       210       220       230       240     
                                                                                                                                                                                                             180   186

Chain 4 from PDB  Type:PROTEIN  Length:66
 aligned with THIS_ECOLI | O32583 from UniProtKB/Swiss-Prot  Length:66

    Alignment length:66
                                    10        20        30        40        50        60      
           THIS_ECOLI     1 MQILFNDQAMQCAAGQTVHELLEQLDQRQAGAALAINQQIVPREQWAQHIVQDGDQILLFQVIAGG  66
               SCOP domains d1zud4_ 4: Thiamin biosynthesis sulfur carrier protein ThiS        SCOP domains
               CATH domains 1zud400 4:1-66  [code=3.10.20.30, no name defined]                 CATH domains
           Pfam domains (1) --ThiS-1zud401 4:3-66                                              Pfam domains (1)
           Pfam domains (2) --ThiS-1zud402 4:3-66                                              Pfam domains (2)
         Sec.struct. author .eeee..eeee.....hhhhhhhhh......eeeee..ee.hhhhh.........eeeeee..... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------ Transcript
                 1zud 4   1 MQILFNDQAMQCAAGQTVHELLEQLDQRQAGAALAINQQIVPREQWAQHIVQDGDQILLFQVIAGG  66
                                    10        20        30        40        50        60

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: 3-Layer(aba) Sandwich (12045)

Topology: Rossmann fold (7312)

Homologous Superfamily: NAD(P)-binding Rossmann-like Domain (1244)

Escherichia coli k12. Organism_taxid: 83333. Strain: k12. (1)

1a	1zud100	1:1-245
1b	1zud300	3:1-245

Architecture: Roll (3276)

Topology: Ubiquitin-like (UB roll) (674)

Homologous Superfamily: [code=3.10.20.30, no name defined] (153)

Escherichia coli k12. Organism_taxid: 83333. Strain: k12. (1)

2a	1zud400	4:1-66
2b	1zud200	2:2-66

Asymmetric Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: NADP_Rossmann (1239)

Family: ThiF (14)

Escherichia coli (strain K12) (6)

1a	ThiF-1zud301	3:27-161
1b	ThiF-1zud302	3:27-161

Clan: Ubiquitin (279)

Family: ThiS (18)

Escherichia coli (strain K12) (5)

2a	ThiS-1zud401	4:3-66
2b	ThiS-1zud402	4:3-66

Clan: no clan defined [family: MoeZ_MoeB] (6)

Family: MoeZ_MoeB (6)

Escherichia coli (strain K12) (6)

3a	MoeZ_MoeB-1zud303	3:166-245
3b	MoeZ_MoeB-1zud304	3:166-245

Asymmetric Unit(hide GO term definitions)

Chain 1,3 (THIF_ECOLI | P30138)

molecular function
	GO:0005524	ATP binding	Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
	GO:0000287	magnesium ion binding	Interacting selectively and non-covalently with magnesium (Mg) ions.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0000166	nucleotide binding	Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
	GO:0016779	nucleotidyltransferase activity	Catalysis of the transfer of a nucleotidyl group to a reactant.
	GO:0008641	small protein activating enzyme activity	Catalysis of the activation of small proteins, such as ubiquitin or ubiquitin-like proteins, through the formation of an ATP-dependent high-energy thiolester bond.
	GO:0016740	transferase activity	Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
	GO:0008270	zinc ion binding	Interacting selectively and non-covalently with zinc (Zn) ions.
biological process
	GO:0006464	cellular protein modification process	The covalent alteration of one or more amino acids occurring in proteins, peptides and nascent polypeptides (co-translational, post-translational modifications) occurring at the level of an individual cell. Includes the modification of charged tRNAs that are destined to occur in a protein (pre-translation modification).
	GO:0009228	thiamine biosynthetic process	The chemical reactions and pathways resulting in the formation of thiamine (vitamin B1), a water soluble vitamin present in fresh vegetables and meats, especially liver.
	GO:0009229	thiamine diphosphate biosynthetic process	The chemical reactions and pathways resulting in the formation of thiamine diphosphate, a derivative of thiamine (vitamin B1) which acts as a coenzyme in a range of processes including the Krebs cycle.
cellular component
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.

Chain 2,4 (THIS_ECOLI | O32583)

molecular function
	GO:0000166	nucleotide binding	Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
biological process
	GO:0009228	thiamine biosynthetic process	The chemical reactions and pathways resulting in the formation of thiamine (vitamin B1), a water soluble vitamin present in fresh vegetables and meats, especially liver.
	GO:0009229	thiamine diphosphate biosynthetic process	The chemical reactions and pathways resulting in the formation of thiamine diphosphate, a derivative of thiamine (vitamin B1) which acts as a coenzyme in a range of processes including the Krebs cycle.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		CA	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		NA	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		ZN	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Pro 1:163 - Pro 1:164	[ RasMol ]
		Pro 3:163 - Pro 3:164	[ RasMol ]

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]
		Biological Unit 3	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format \| Biol. Unit 2 PNG format \| Biol. Unit 3 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1zud
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	THIF_ECOLI \| P30138
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	THIS_ECOLI \| O32583
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	2.7.7.-
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	THIF_ECOLI \| P30138
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	THIS_ECOLI \| O32583
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	THIF_ECOLI \| P30138	:	1zfn 1zkm
	THIS_ECOLI \| O32583	:	1f0z

(no "Related Entries Specified in the PDB File" available for 1ZUD)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (3, 6)

Sites (6, 6)

SS Bonds (0, 0)

Cis Peptide Bonds (2, 2)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (2, 4)

CATH Domains (2, 4)

Pfam Domains (3, 6)

Gene Ontology (12, 15)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File