1ZNO - JenaLib

Title :   CRYSTAL STRUCTURE OF VC702 FROM VIBRIO CHOLERAE, NORTHEAST STRUCTURAL GENOMICS CONSORTIUM TARGET: VCP1

Authors :   S. Ni, F. Forouhar, D. E. Bussiere, H. Robinson, M. A. Kennedy, Northeast Structural Genomics Consortium (Nesg)

Date :   11 May 05 (Deposition) - 04 Jul 06 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.00

Chains :   Asym. Unit : A,B
Biol. Unit 1: A,B  (1x)
Biol. Unit 2: A,B  (2x)

Keywords :   Mixed Alpha/Beta Sandwich, Homodimer, Structural Genomics, Psi, Protein Structure Initiative, Northeast Structural Genomics Consortium, Nesg, Unknown Function (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   S. Ni, F. Forouhar, D. E. Bussiere, H. Robinson, M. A. Kennedy
Crystal Structure Of Vc0702 At 2. 0 A: Conserved Hypothetical Protein From Vibrio Cholerae.
Proteins V. 63 733 2006
PubMed-ID: 16498616 | Reference-DOI: 10.1002/PROT.20919
(for further references see the PDB file header)

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (2, 13)

Sites (3, 3)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:165
 aligned with NCPP_VIBCH | Q9KU27 from UniProtKB/Swiss-Prot  Length:183

    Alignment length:173
                                    19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179   
           NCPP_VIBCH    10 MRKIIIASQNPAKVNAVRSAFSTVFPDQEWEFIGVSVPSEVADQPMSDEETKQGALNRVRNAKQRHPGAEYYVGLEAGIEENKTFAWMIVESDQQRGESRSACLMLPPLVLERLRQAKELGDVMDEVFGTENIKQKGGAIGLLTRHHLTRSTVYHQALILALIPFINPEHYPS 182
               SCOP domains d1znoa_ A: automated matches                                                                                                                                                  SCOP domains
               CATH domains -1znoA00 A:11-182  [code=3.90.950.10, no name defined]                                                                                                                        CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeee...hhhhhhhhhhhhhhhh....eeeee............hhhhhhhhhhhhhhhhhhhh....eeeeeeeeee..eeeeeeeee....eeeee...ee.hhhhhhh.-----hhhhhhh.---......hhhhhhhh....hhhhhhhhhhhhhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1zno A  10 mRKIIIASQNPAKVNAVRSAFSTVFPDQEWEFIGVSVPSEVADQPmSDEETKQGALNRVRNAKQRHPGAEYYVGLEAGIEENKTFAWmIVESDQQRGESRSACLmLPPLVLERL-----LGDVmDEV---ENIKQKGGAIGLLTRHHLTRSTVYHQALILALIPFINPEHYPS 182
                            |       19        29        39        49     |  59        69        79        89       |99       109    |  119   |   129   |  |  -|      149       159       169       179   
                            |                                           55-MSE                                    97-MSE          114-MSE  123   129   |  | 140                                          
                           10-MSE                                                                                                                    133-MSE                                             
                                                                                                                                                        136

Chain B from PDB  Type:PROTEIN  Length:165
 aligned with NCPP_VIBCH | Q9KU27 from UniProtKB/Swiss-Prot  Length:183

    Alignment length:173
                                    19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179   
           NCPP_VIBCH    10 MRKIIIASQNPAKVNAVRSAFSTVFPDQEWEFIGVSVPSEVADQPMSDEETKQGALNRVRNAKQRHPGAEYYVGLEAGIEENKTFAWMIVESDQQRGESRSACLMLPPLVLERLRQAKELGDVMDEVFGTENIKQKGGAIGLLTRHHLTRSTVYHQALILALIPFINPEHYPS 182
               SCOP domains d1znob_ B: automated matches                                                                                                                                                  SCOP domains
               CATH domains -1znoB00 B:11-182  [code=3.90.950.10, no name defined]                                                                                                                        CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeee...hhhhhhhhhhhhhhhh.....eeee............hhhhhhhhhhhhhhhhhhhh....eeeeeeeeee..eeeeeeeee....eeeee...ee.hhhhhhh.....--......------....hhhhhhhh....hhhhhhhhhhhhhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1zno B  10 mRKIIIASQNPAKVNAVRSAFSTVFPDQEWEFIGVSVPSEVADQPmSDEETKQGALNRVRNAKQRHPGAEYYVGLEAGIEENKTFAWmIVESDQQRGESRSACLmLPPLVLERLRQAK--GDVmDE------IKQKGGAIGLLTRHHLTRSTVYHQALILALIPFINPEHYPS 182
                            |       19        29        39        49     |  59        69        79        89       |99       109    |  119       | -|  | |   -  |    149       159       169       179   
                           10-MSE                                       55-MSE                                    97-MSE          114-MSE      127  |  | |    142                                        
                                                                                                                                                  130  | |                                               
                                                                                                                                                     133-MSE                                             
                                                                                                                                                       135

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 2)

CATH Domains (1, 2)

Pfam Domains (0, 0)

Gene Ontology (8, 8)

Asymmetric Unit(hide GO term definitions)

Chain A,B (NCPP_VIBCH | Q9KU27)

molecular function
	GO:0016787	hydrolase activity	Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0003674	molecular_function	Elemental activities, such as catalysis or binding, describing the actions of a gene product at the molecular level. A given gene product may exhibit one or more molecular functions.
	GO:0017111	nucleoside-triphosphatase activity	Catalysis of the reaction: a nucleoside triphosphate + H2O = nucleoside diphosphate + phosphate.
	GO:0000166	nucleotide binding	Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
biological process
	GO:0008150	biological_process	Any process specifically pertinent to the functioning of integrated living units: cells, tissues, organs, and organisms. A process is a collection of molecular events with a defined beginning and end.
	GO:0009117	nucleotide metabolic process	The chemical reactions and pathways involving a nucleotide, a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the glycose moiety; may be mono-, di- or triphosphate; this definition includes cyclic nucleotides (nucleoside cyclic phosphates).
cellular component
	GO:0005575	cellular_component	The part of a cell, extracellular environment or virus in which a gene product is located. A gene product may be located in one or more parts of a cell and its location may be as specific as a particular macromolecular complex, that is, a stable, persistent association of macromolecules that function together.

Visualization

Interactive Views

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		MG	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		MSE	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1zno)

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	1zno
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	NCPP_VIBCH \| Q9KU27
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Description