1Z9O - JenaLib

Asym./Biol. Unit (Jmol Viewer)

Title :   1.9 ANGSTROM CRYSTAL STRUCTURE OF THE RAT VAP-A MSP HOMOLOGY DOMAIN IN COMPLEX WITH THE RAT ORP1 FFAT MOTIF

Authors :   S. E. Kaiser, J. H. Brickner, A. R. Reilein, T. D. Fenn, P. Walter, A. T. Br

Date :   03 Apr 05 (Deposition) - 19 Jul 05 (Release) - 13 Jul 11 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.90

Chains :   Asym./Biol. Unit : A,B,C,D,E,F,G,H,I,J,K,L

Keywords :   Vap-33, Vap-A, Vap-B, Vap-C, Vapa, Vapb, Vapc, Vap-33A, Scs2, Erg30, Ffat Motif, Er, Endoplasmic Reticulum, Targeting, Immunoglobulin- Like Beta Sheet, Msp Homology Domain, Osbp, Orp, Oxysterol Binding Protein, Protein Binding-Lipid Binding Protein Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   S. E. Kaiser, J. H. Brickner, A. R. Reilein, T. D. Fenn, P. Walter, A. T. Brunger
Structural Basis Of Ffat Motif-Mediated Er Targeting
Structure V. 13 1035 2005
PubMed-ID: 16004875 | Reference-DOI: 10.1016/J.STR.2005.04.010

Molecule 1 - VESICLE-ASSOCIATED MEMBRANE PROTEIN-ASSOCIATED PROTEIN A
	Chains	:	A, B, C, D, E, F
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI BL21
	Expression System Plasmid	:	PGEX
	Expression System Strain	:	BL21
	Expression System Taxid	:	511693
	Expression System Vector Type	:	PLASMID
	Gene	:	VAPA, VAP33
	Organism Common	:	NORWAY RAT
	Organism Scientific	:	RATTUS NORVEGICUS
	Organism Taxid	:	10116
	Synonym	:	VAMP- ASSOCIATED PROTEIN A, VAMP-A, VAP-A, 33 KDA VAMP- ASSOCIATED PROTEIN, VAP-33

Molecule 2 - OXYSTEROL BINDING PROTEIN
	Chains	:	G, H, I, J, K, L
	Engineered	:	YES
	Fragment	:	RESIDUES 472-481
	Other Details	:	PEPTIDE NH2-SEDEFYDALS-COO CORRESPONDING TO RAT ORP1 472-481 SYNTHESIZED BY BIOPEPTIDE LLC
	Synonym	:	ORP-1
	Synthetic	:	YES

		1	2	3	4	5	6	7	8	9	10	11	12
Asymmetric/Biological Unit	:	A	B	C	D	E	F	G	H	I	J	K	L

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 1Z9O)

(no "Site" information available for 1Z9O)

(no "SS Bond" information available for 1Z9O)

Asymmetric/Biological Unit

No.	Residues
1	Asp A:11	-	Pro A:12
2	Gly A:20	-	Pro A:21
3	Arg A:55	-	Pro A:56
4	Asp B:11	-	Pro B:12
5	Gly B:20	-	Pro B:21
6	Arg B:55	-	Pro B:56
7	Asp C:11	-	Pro C:12
8	Gly C:20	-	Pro C:21
9	Arg C:55	-	Pro C:56
10	Asp D:11	-	Pro D:12
11	Gly D:20	-	Pro D:21
12	Arg D:55	-	Pro D:56
13	Asp E:11	-	Pro E:12
14	Gly E:20	-	Pro E:21
15	Arg E:55	-	Pro E:56
16	Asp F:11	-	Pro F:12
17	Gly F:20	-	Pro F:21
18	Arg F:55	-	Pro F:56

(no "SAP(SNP)/Variant" information available for 1Z9O)

Asymmetric/Biological Unit (1, 6)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	MSP	PS50202	Major sperm protein (MSP) domain profile.	VAPA_RAT	14-131	6	A:7-124 B:7-124 C:7-124 D:7-124 E:7-124 F:7-124

Asymmetric/Biological Unit (4, 24)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1	ENSRNOT00000020681	1	ENSRNOE00000228922	chr9:104368908-104368599	310	VAPA_RAT	1-27	27	6	A:5-20 B:5-20 C:5-20 D:5-20 E:5-20 F:5-20	16 16 16 16 16 16
1.2	ENSRNOT00000020681	2	ENSRNOE00000143212	chr9:104351695-104351543	153	VAPA_RAT	27-78	52	6	A:20-71 B:20-71 C:20-71 D:20-71 E:20-71 F:20-71	52 52 52 52 52 52
1.3	ENSRNOT00000020681	3	ENSRNOE00000143785	chr9:104350873-104350770	104	VAPA_RAT	78-112	35	6	A:71-105 (gaps) B:71-105 (gaps) C:71-105 (gaps) D:71-105 (gaps) E:71-105 (gaps) F:71-105 (gaps)	35 35 35 35 35 35
1.4	ENSRNOT00000020681	4	ENSRNOE00000144310	chr9:104350054-104349974	81	VAPA_RAT	113-139	27	6	A:106-125 B:106-125 C:106-125 D:106-125 E:106-125 F:106-125	20 20 20 20 20 20
1.5	ENSRNOT00000020681	5	ENSRNOE00000144838	chr9:104341327-104341154	174	VAPA_RAT	140-197	58	0	-	-
1.6	ENSRNOT00000020681	6	ENSRNOE00000228905	chr9:104339821-104339042	780	VAPA_RAT	198-249	52	0	-	-

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:119
 aligned with VAPA_RAT | Q9Z270 from UniProtKB/Swiss-Prot  Length:249

    Alignment length:121
                                    21        31        41        51        61        71        81        91       101       111       121       131 
             VAPA_RAT    12 EQILVLDPPSDLKFKGPFTDVVTTNLKLQNPSDRKVCFKVKTTAPRRYCVRPNSGVIDPGSIVTVSVMLQPFDYDPNEKSKHKFMVQTIFAPPNISDMEAVWKEAKPDELMDSKLRCVFEM 132
               SCOP domains ------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eee...eeeee......eeeeeeee......eeeeeee.hhh.eeee..eeee....eeeeeeee.............eeeeeeee...--.hhhhhhhhhhhhhheeeeeeeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --MSP  PDB: A:7-124 UniProt: 14-131                                                                                     - PROSITE
           Transcript 1 (1) Exon 1.1        --------------------------------------------------Exon 1.3  PDB: A:71-105 (gaps)     Exon 1.4             Transcript 1 (1)
           Transcript 1 (2) ---------------Exon 1.2  PDB: A:20-71 UniProt: 27-78               ------------------------------------------------------ Transcript 1 (2)
                 1z9o A   5 EQILVLDPPSDLKFKGPFTDVVTTNLKLQNPSDRKVCFKVKTTAPRRYCVRPNSGVIDPGSIVTVSVMLQPFDYDPNEKSKHKFMVQTIFAPP--SDMEAVWKEAKPDELMDSKLRCVFEM 125
                                    14        24        34        44        54        64        74        84        94  |  | 104       114       124 
                                                                                                                       97  |                         
                                                                                                                         100

Chain B from PDB  Type:PROTEIN  Length:119
 aligned with VAPA_RAT | Q9Z270 from UniProtKB/Swiss-Prot  Length:249

    Alignment length:121
                                    21        31        41        51        61        71        81        91       101       111       121       131 
             VAPA_RAT    12 EQILVLDPPSDLKFKGPFTDVVTTNLKLQNPSDRKVCFKVKTTAPRRYCVRPNSGVIDPGSIVTVSVMLQPFDYDPNEKSKHKFMVQTIFAPPNISDMEAVWKEAKPDELMDSKLRCVFEM 132
               SCOP domains ------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eee...eeeee......eeeeeeee......eeeeeee.hhh.eeee..eeee....eeeeeeee.............eeeeeeee...--.hhhhhhhhhhhhhheeeeeeeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --MSP  PDB: B:7-124 UniProt: 14-131                                                                                     - PROSITE
           Transcript 1 (1) Exon 1.1        --------------------------------------------------Exon 1.3  PDB: B:71-105 (gaps)     Exon 1.4             Transcript 1 (1)
           Transcript 1 (2) ---------------Exon 1.2  PDB: B:20-71 UniProt: 27-78               ------------------------------------------------------ Transcript 1 (2)
                 1z9o B   5 EQILVLDPPSDLKFKGPFTDVVTTNLKLQNPSDRKVCFKVKTTAPRRYCVRPNSGVIDPGSIVTVSVMLQPFDYDPNEKSKHKFMVQTIFAPP--SDMEAVWKEAKPDELMDSKLRCVFEM 125
                                    14        24        34        44        54        64        74        84        94  |  | 104       114       124 
                                                                                                                       97  |                         
                                                                                                                         100

Chain C from PDB  Type:PROTEIN  Length:119
 aligned with VAPA_RAT | Q9Z270 from UniProtKB/Swiss-Prot  Length:249

    Alignment length:121
                                    21        31        41        51        61        71        81        91       101       111       121       131 
             VAPA_RAT    12 EQILVLDPPSDLKFKGPFTDVVTTNLKLQNPSDRKVCFKVKTTAPRRYCVRPNSGVIDPGSIVTVSVMLQPFDYDPNEKSKHKFMVQTIFAPPNISDMEAVWKEAKPDELMDSKLRCVFEM 132
               SCOP domains ------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eee...eeeee......eeeeeeee......eeeeeee.hhh.eeee..eeee....eeeeeeee.............eeeeeeee...--.hhhhhhhhhhhhhheeeeeeeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --MSP  PDB: C:7-124 UniProt: 14-131                                                                                     - PROSITE
           Transcript 1 (1) Exon 1.1        --------------------------------------------------Exon 1.3  PDB: C:71-105 (gaps)     Exon 1.4             Transcript 1 (1)
           Transcript 1 (2) ---------------Exon 1.2  PDB: C:20-71 UniProt: 27-78               ------------------------------------------------------ Transcript 1 (2)
                 1z9o C   5 EQILVLDPPSDLKFKGPFTDVVTTNLKLQNPSDRKVCFKVKTTAPRRYCVRPNSGVIDPGSIVTVSVMLQPFDYDPNEKSKHKFMVQTIFAPP--SDMEAVWKEAKPDELMDSKLRCVFEM 125
                                    14        24        34        44        54        64        74        84        94  |  | 104       114       124 
                                                                                                                       97  |                         
                                                                                                                         100

Chain D from PDB  Type:PROTEIN  Length:119
 aligned with VAPA_RAT | Q9Z270 from UniProtKB/Swiss-Prot  Length:249

    Alignment length:121
                                    21        31        41        51        61        71        81        91       101       111       121       131 
             VAPA_RAT    12 EQILVLDPPSDLKFKGPFTDVVTTNLKLQNPSDRKVCFKVKTTAPRRYCVRPNSGVIDPGSIVTVSVMLQPFDYDPNEKSKHKFMVQTIFAPPNISDMEAVWKEAKPDELMDSKLRCVFEM 132
               SCOP domains ------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eee...eeeee......eeeeeeee......eeeeeee.hhh.eeee..eeee....eeeeeeee.............eeeeeeee...--.hhhhhhhhhhhhhheeeeeeeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --MSP  PDB: D:7-124 UniProt: 14-131                                                                                     - PROSITE
           Transcript 1 (1) Exon 1.1        --------------------------------------------------Exon 1.3  PDB: D:71-105 (gaps)     Exon 1.4             Transcript 1 (1)
           Transcript 1 (2) ---------------Exon 1.2  PDB: D:20-71 UniProt: 27-78               ------------------------------------------------------ Transcript 1 (2)
                 1z9o D   5 EQILVLDPPSDLKFKGPFTDVVTTNLKLQNPSDRKVCFKVKTTAPRRYCVRPNSGVIDPGSIVTVSVMLQPFDYDPNEKSKHKFMVQTIFAPP--SDMEAVWKEAKPDELMDSKLRCVFEM 125
                                    14        24        34        44        54        64        74        84        94  |  | 104       114       124 
                                                                                                                       97  |                         
                                                                                                                         100

Chain E from PDB  Type:PROTEIN  Length:119
 aligned with VAPA_RAT | Q9Z270 from UniProtKB/Swiss-Prot  Length:249

    Alignment length:121
                                    21        31        41        51        61        71        81        91       101       111       121       131 
             VAPA_RAT    12 EQILVLDPPSDLKFKGPFTDVVTTNLKLQNPSDRKVCFKVKTTAPRRYCVRPNSGVIDPGSIVTVSVMLQPFDYDPNEKSKHKFMVQTIFAPPNISDMEAVWKEAKPDELMDSKLRCVFEM 132
               SCOP domains ------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eee...eeeee......eeeeeeee......eeeeeee.hhh.eeee..eeee....eeeeeeee.............eeeeeeee...--.hhhhhhhhhhhhhheeeeeeeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --MSP  PDB: E:7-124 UniProt: 14-131                                                                                     - PROSITE
           Transcript 1 (1) Exon 1.1        --------------------------------------------------Exon 1.3  PDB: E:71-105 (gaps)     Exon 1.4             Transcript 1 (1)
           Transcript 1 (2) ---------------Exon 1.2  PDB: E:20-71 UniProt: 27-78               ------------------------------------------------------ Transcript 1 (2)
                 1z9o E   5 EQILVLDPPSDLKFKGPFTDVVTTNLKLQNPSDRKVCFKVKTTAPRRYCVRPNSGVIDPGSIVTVSVMLQPFDYDPNEKSKHKFMVQTIFAPP--SDMEAVWKEAKPDELMDSKLRCVFEM 125
                                    14        24        34        44        54        64        74        84        94  |  | 104       114       124 
                                                                                                                       97  |                         
                                                                                                                         100

Chain F from PDB  Type:PROTEIN  Length:119
 aligned with VAPA_RAT | Q9Z270 from UniProtKB/Swiss-Prot  Length:249

    Alignment length:121
                                    21        31        41        51        61        71        81        91       101       111       121       131 
             VAPA_RAT    12 EQILVLDPPSDLKFKGPFTDVVTTNLKLQNPSDRKVCFKVKTTAPRRYCVRPNSGVIDPGSIVTVSVMLQPFDYDPNEKSKHKFMVQTIFAPPNISDMEAVWKEAKPDELMDSKLRCVFEM 132
               SCOP domains ------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) --Motile_Sperm-1z9oF01 F:7-113                                                                               ------------ Pfam domains (1)
           Pfam domains (2) --Motile_Sperm-1z9oF02 F:7-113                                                                               ------------ Pfam domains (2)
           Pfam domains (3) --Motile_Sperm-1z9oF03 F:7-113                                                                               ------------ Pfam domains (3)
           Pfam domains (4) --Motile_Sperm-1z9oF04 F:7-113                                                                               ------------ Pfam domains (4)
           Pfam domains (5) --Motile_Sperm-1z9oF05 F:7-113                                                                               ------------ Pfam domains (5)
           Pfam domains (6) --Motile_Sperm-1z9oF06 F:7-113                                                                               ------------ Pfam domains (6)
         Sec.struct. author ....eee...eeeee......eeeeeeee......eeeeeee.hhh.eeee..eeee....eeeeeeee.............eeeeeeee...--.hhhhhhhhhhhhhheeeeeeeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --MSP  PDB: F:7-124 UniProt: 14-131                                                                                     - PROSITE
           Transcript 1 (1) Exon 1.1        --------------------------------------------------Exon 1.3  PDB: F:71-105 (gaps)     Exon 1.4             Transcript 1 (1)
           Transcript 1 (2) ---------------Exon 1.2  PDB: F:20-71 UniProt: 27-78               ------------------------------------------------------ Transcript 1 (2)
                 1z9o F   5 EQILVLDPPSDLKFKGPFTDVVTTNLKLQNPSDRKVCFKVKTTAPRRYCVRPNSGVIDPGSIVTVSVMLQPFDYDPNEKSKHKFMVQTIFAPP--SDMEAVWKEAKPDELMDSKLRCVFEM 125
                                    14        24        34        44        54        64        74        84        94  |  | 104       114       124 
                                                                                                                       97  |                         
                                                                                                                         100

Chain G from PDB  Type:PROTEIN  Length:9
 aligned with OSBL1_RAT | Q8K4M9 from UniProtKB/Swiss-Prot  Length:950

    Alignment length:9
            OSBL1_RAT   473 EDEFYDALS 481
               SCOP domains --------- SCOP domains
               CATH domains --------- CATH domains
               Pfam domains --------- Pfam domains
         Sec.struct. author ....ee... Sec.struct. author
                 SAPs(SNPs) --------- SAPs(SNPs)
                    PROSITE --------- PROSITE
                 Transcript --------- Transcript
                 1z9o G 473 EDEFYDALS 481

Chain H from PDB  Type:PROTEIN  Length:9
 aligned with OSBL1_RAT | Q8K4M9 from UniProtKB/Swiss-Prot  Length:950

    Alignment length:9
            OSBL1_RAT   473 EDEFYDALS 481
               SCOP domains --------- SCOP domains
               CATH domains --------- CATH domains
               Pfam domains --------- Pfam domains
         Sec.struct. author ....ee... Sec.struct. author
                 SAPs(SNPs) --------- SAPs(SNPs)
                    PROSITE --------- PROSITE
                 Transcript --------- Transcript
                 1z9o H 473 EDEFYDALS 481

Chain I from PDB  Type:PROTEIN  Length:9
 aligned with OSBL1_RAT | Q8K4M9 from UniProtKB/Swiss-Prot  Length:950

    Alignment length:9
            OSBL1_RAT   473 EDEFYDALS 481
               SCOP domains --------- SCOP domains
               CATH domains --------- CATH domains
               Pfam domains --------- Pfam domains
         Sec.struct. author ....ee... Sec.struct. author
                 SAPs(SNPs) --------- SAPs(SNPs)
                    PROSITE --------- PROSITE
                 Transcript --------- Transcript
                 1z9o I 473 EDEFYDALS 481

Chain J from PDB  Type:PROTEIN  Length:9
 aligned with OSBL1_RAT | Q8K4M9 from UniProtKB/Swiss-Prot  Length:950

    Alignment length:9
            OSBL1_RAT   473 EDEFYDALS 481
               SCOP domains --------- SCOP domains
               CATH domains --------- CATH domains
               Pfam domains --------- Pfam domains
         Sec.struct. author ....ee... Sec.struct. author
                 SAPs(SNPs) --------- SAPs(SNPs)
                    PROSITE --------- PROSITE
                 Transcript --------- Transcript
                 1z9o J 473 EDEFYDALS 481

Chain K from PDB  Type:PROTEIN  Length:9
 aligned with OSBL1_RAT | Q8K4M9 from UniProtKB/Swiss-Prot  Length:950

    Alignment length:9
            OSBL1_RAT   473 EDEFYDALS 481
               SCOP domains --------- SCOP domains
               CATH domains --------- CATH domains
               Pfam domains --------- Pfam domains
         Sec.struct. author ....ee... Sec.struct. author
                 SAPs(SNPs) --------- SAPs(SNPs)
                    PROSITE --------- PROSITE
                 Transcript --------- Transcript
                 1z9o K 473 EDEFYDALS 481

Chain L from PDB  Type:PROTEIN  Length:9
 aligned with OSBL1_RAT | Q8K4M9 from UniProtKB/Swiss-Prot  Length:950

    Alignment length:9
            OSBL1_RAT   473 EDEFYDALS 481
               SCOP domains --------- SCOP domains
               CATH domains --------- CATH domains
               Pfam domains --------- Pfam domains
         Sec.struct. author ....ee... Sec.struct. author
                 SAPs(SNPs) --------- SAPs(SNPs)
                    PROSITE --------- PROSITE
                 Transcript --------- Transcript
                 1z9o L 473 EDEFYDALS 481

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

(no "SCOP Domain" information available for 1Z9O)

(no "CATH Domain" information available for 1Z9O)

Asymmetric/Biological Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: no clan defined [family: Motile_Sperm] (7)

Family: Motile_Sperm (7)

Rattus norvegicus (Rat) (1)

1a	Motile_Sperm-1z9oF01	F:7-113
1b	Motile_Sperm-1z9oF02	F:7-113
1c	Motile_Sperm-1z9oF03	F:7-113
1d	Motile_Sperm-1z9oF04	F:7-113
1e	Motile_Sperm-1z9oF05	F:7-113
1f	Motile_Sperm-1z9oF06	F:7-113

Asymmetric/Biological Unit(hide GO term definitions)

Chain A,B,C,D,E,F (VAPA_RAT | Q9Z270)

molecular function
	GO:0033149	FFAT motif binding	Interacting selectively and non-covalently with the FFAT motif, a short motif containing diphenylalanine in an acidic tract that targets proteins to the cytosolic surface of the ER and to the nuclear membrane by binding directly to members of the VAP (VAMP-associated protein) protein family.
	GO:0046982	protein heterodimerization activity	Interacting selectively and non-covalently with a nonidentical protein to form a heterodimer.
biological process
	GO:0008219	cell death	Any biological process that results in permanent cessation of all vital functions of a cell. A cell should be considered dead when any one of the following molecular or morphological criteria is met: (1) the cell has lost the integrity of its plasma membrane; (2) the cell, including its nucleus, has undergone complete fragmentation into discrete bodies (frequently referred to as apoptotic bodies). The cell corpse (or its fragments) may be engulfed by an adjacent cell in vivo, but engulfment of whole cells should not be considered a strict criteria to define cell death as, under some circumstances, live engulfed cells can be released from phagosomes (see PMID:18045538).
	GO:0031175	neuron projection development	The process whose specific outcome is the progression of a neuron projection over time, from its formation to the mature structure. A neuron projection is any process extending from a neural cell, such as axons or dendrites (collectively called neurites).
	GO:0070972	protein localization to endoplasmic reticulum	A process in which a protein is transported to, or maintained in, a location within the endoplasmic reticulum.
cellular component
	GO:0005923	bicellular tight junction	An occluding cell-cell junction that is composed of a branching network of sealing strands that completely encircles the apical end of each cell in an epithelial sheet; the outer leaflets of the two interacting plasma membranes are seen to be tightly apposed where sealing strands are present. Each sealing strand is composed of a long row of transmembrane adhesion proteins embedded in each of the two interacting plasma membranes.
	GO:0030054	cell junction	A cellular component that forms a specialized region of connection between two or more cells or between a cell and the extracellular matrix. At a cell junction, anchoring proteins extend through the plasma membrane to link cytoskeletal proteins in one cell to cytoskeletal proteins in neighboring cells or to proteins in the extracellular matrix.
	GO:0005783	endoplasmic reticulum	The irregular network of unit membranes, visible only by electron microscopy, that occurs in the cytoplasm of many eukaryotic cells. The membranes form a complex meshwork of tubular channels, which are often expanded into slitlike cavities called cisternae. The ER takes two forms, rough (or granular), with ribosomes adhering to the outer surface, and smooth (with no ribosomes attached).
	GO:0005789	endoplasmic reticulum membrane	The lipid bilayer surrounding the endoplasmic reticulum.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0031965	nuclear membrane	Either of the lipid bilayers that surround the nucleus and form the nuclear envelope; excludes the intermembrane space.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Chain G,H,I,J,K,L (OSBL1_RAT | Q8K4M9)

molecular function
	GO:0008289	lipid binding	Interacting selectively and non-covalently with a lipid.
biological process
	GO:0006869	lipid transport	The directed movement of lipids into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore. Lipids are compounds soluble in an organic solvent but not, or sparingly, in an aqueous solvent.
	GO:0006810	transport	The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
	GO:0005768	endosome	A vacuole to which materials ingested by endocytosis are delivered.
	GO:0005770	late endosome	A prelysosomal endocytic organelle differentiated from early endosomes by lower lumenal pH and different protein composition. Late endosomes are more spherical than early endosomes and are mostly juxtanuclear, being concentrated near the microtubule organizing center.

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1z9o)

	Sites
(no "Sites" information available for 1z9o)

	Cis Peptide Bonds
		Arg A:55 - Pro A:56	[ RasMol ]
		Arg B:55 - Pro B:56	[ RasMol ]
		Arg C:55 - Pro C:56	[ RasMol ]
		Arg D:55 - Pro D:56	[ RasMol ]
		Arg E:55 - Pro E:56	[ RasMol ]
		Arg F:55 - Pro F:56	[ RasMol ]
		Asp A:11 - Pro A:12	[ RasMol ]
		Asp B:11 - Pro B:12	[ RasMol ]
		Asp C:11 - Pro C:12	[ RasMol ]
		Asp D:11 - Pro D:12	[ RasMol ]
		Asp E:11 - Pro E:12	[ RasMol ]
		Asp F:11 - Pro F:12	[ RasMol ]
		Gly A:20 - Pro A:21	[ RasMol ]
		Gly B:20 - Pro B:21	[ RasMol ]
		Gly C:20 - Pro C:21	[ RasMol ]
		Gly D:20 - Pro D:21	[ RasMol ]
		Gly E:20 - Pro E:21	[ RasMol ]
		Gly F:20 - Pro F:21	[ RasMol ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1z9o
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	OSBL1_RAT \| Q8K4M9
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	VAPA_RAT \| Q9Z270
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	OSBL1_RAT \| Q8K4M9
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	VAPA_RAT \| Q9Z270
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	VAPA_RAT \| Q9Z270	:	1z9l

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (18, 18)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (1, 6)

Exons (4, 24)

Sequences/Alignments

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (1, 6)

Gene Ontology (19, 19)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File