|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric Unit (2, 6) Biological Unit 1 (2, 2) Biological Unit 2 (2, 2) Biological Unit 3 (2, 2) |
Asymmetric Unit (3, 3)
|
(no "SS Bond" information available for 1Z0N) |
(no "Cis Peptide Bond" information available for 1Z0N) |
(no "SAP(SNP)/Variant" information available for 1Z0N) |
(no "PROSITE Motif" information available for 1Z0N) |
Asymmetric Unit (3, 9)
|
Asymmetric UnitChain A from PDB Type:PROTEIN Length:87 aligned with AAKB1_RAT | P80386 from UniProtKB/Swiss-Prot Length:270 Alignment length:87 86 96 106 116 126 136 146 156 AAKB1_RAT 77 ARPTVFRWTGGGKEVYLSGSFNNWSKLPLTRSQNNFVAILDLPEGEHQYKFFVDGQWTHDPSEPIVTSQLGTVNNIIQVKKTDFEVF 163 SCOP domains d1z0na1 A:77-163 5'-AMP-activated protein kinase subunit beta-1 SCOP domains CATH domains --------------------------------------------------------------------------------------- CATH domains Pfam domains --------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------------------------------------- PROSITE Transcript 1 (1) Exon 1.2 PDB: A:77-108 -------------------------------Exon 1.4 PDB: A:140-163 Transcript 1 (1) Transcript 1 (2) -------------------------------Exon 1.3 PDB: A:108-139 ------------------------ Transcript 1 (2) 1z0n A 77 ARPTVFRWTGGGKEVYLSGSFNNWSKLPmTRSQNNFVAILDLPEGEHQYKFFVDGQWTHDPSEPIVTSQLGTVNNIIQVKKTDFEVF 163 86 96 106 116 126 136 146 156 105-MSE Chain B from PDB Type:PROTEIN Length:80 aligned with AAKB1_RAT | P80386 from UniProtKB/Swiss-Prot Length:270 Alignment length:80 86 96 106 116 126 136 146 156 AAKB1_RAT 77 ARPTVFRWTGGGKEVYLSGSFNNWSKLPLTRSQNNFVAILDLPEGEHQYKFFVDGQWTHDPSEPIVTSQLGTVNNIIQVK 156 SCOP domains d1z0nb_ B: automated matches SCOP domains CATH domains -------------------------------------------------------------------------------- CATH domains Pfam domains -------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------------------------------- PROSITE Transcript 1 (1) Exon 1.2 PDB: B:77-108 -------------------------------Exon 1.4 Transcript 1 (1) Transcript 1 (2) -------------------------------Exon 1.3 PDB: B:108-139 ----------------- Transcript 1 (2) 1z0n B 77 ARPTVFRWTGGGKEVYLSGSFNNWSKLPmTRSQNNFVAILDLPEGEHQYKFFVDGQWTHDPSEPIVTSQLGTVNNIIQVK 156 86 96 106 116 126 136 146 156 105-MSE Chain C from PDB Type:PROTEIN Length:80 aligned with AAKB1_RAT | P80386 from UniProtKB/Swiss-Prot Length:270 Alignment length:80 86 96 106 116 126 136 146 156 AAKB1_RAT 77 ARPTVFRWTGGGKEVYLSGSFNNWSKLPLTRSQNNFVAILDLPEGEHQYKFFVDGQWTHDPSEPIVTSQLGTVNNIIQVK 156 SCOP domains d1z0nc_ C: automated matches SCOP domains CATH domains -------------------------------------------------------------------------------- CATH domains Pfam domains (1) -------------------------------------------------------------------------AMPKBI- Pfam domains (1) Pfam domains (2) -------------------------------------------------------------------------AMPKBI- Pfam domains (2) Pfam domains (3) -------------------------------------------------------------------------AMPKBI- Pfam domains (3) SAPs(SNPs) -------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------------------------------- PROSITE Transcript 1 (1) Exon 1.2 PDB: C:77-108 -------------------------------Exon 1.4 Transcript 1 (1) Transcript 1 (2) -------------------------------Exon 1.3 PDB: C:108-139 ----------------- Transcript 1 (2) 1z0n C 77 ARPTVFRWTGGGKEVYLSGSFNNWSKLPmTRSQNNFVAILDLPEGEHQYKFFVDGQWTHDPSEPIVTSQLGTVNNIIQVK 156 86 96 106 116 126 136 146 156 105-MSE
|
Asymmetric Unit |
(no "CATH Domain" information available for 1Z0N) |
Asymmetric Unit
|
Asymmetric Unit(hide GO term definitions) Chain A,B,C (AAKB1_RAT | P80386)
|
|
|
|
|
|
|