1Z0M - JenaLib

Asymmetric Unit (3, 3)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	TRP A:100 , LYS A:126 , TRP A:133 , SER A:144 , GLN A:145 , LEU A:146 , THR A:148 , ASN A:150 , HOH A:209 , HOH A:226 , HOH A:238 , HOH A:245 , HOH A:259 , HOH A:280 , HOH A:281 , GLY B:87 , GLY B:88 , ASN B:99 , ARG B:107 , ASN B:110 , HOH B:251 , HOH C:209 , HOH C:239	BINDING SITE FOR RESIDUE BCD A 201
2	AC2	SOFTWARE	ALA A:77 , PHE A:97 , ASN A:99 , ASP A:117 , PRO A:119 , HOH A:211 , HOH A:249 , HOH A:253 , HOH A:254 , HOH A:261 , LYS B:126 , TRP B:133 , SER B:144 , GLN B:145 , LEU B:146 , THR B:148 , ASN B:150 , HOH B:206 , HOH B:209 , HOH B:215 , HOH B:237 , HOH B:259	BINDING SITE FOR RESIDUE BCD B 202
3	AC3	SOFTWARE	GLU A:122 , HOH A:275 , SER B:96 , PHE B:97 , PRO B:119 , GLU B:120 , GLU B:122 , HIS B:123 , HOH B:223 , TRP C:100 , LYS C:126 , TRP C:133 , SER C:144 , GLN C:145 , LEU C:146 , THR C:148 , ASN C:150 , HOH C:206 , HOH C:213 , HOH C:215 , HOH C:218 , HOH C:225 , HOH C:240 , HOH C:243 , HOH C:245 , HOH C:248 , HOH C:260	BINDING SITE FOR RESIDUE BCD C 203

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (3, 9)

Sequences/Alignments

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:87
 aligned with AAKB1_RAT | P80386 from UniProtKB/Swiss-Prot  Length:270

    Alignment length:87
                                    86        96       106       116       126       136       146       156       
            AAKB1_RAT    77 ARPTVFRWTGGGKEVYLSGSFNNWSKLPLTRSQNNFVAILDLPEGEHQYKFFVDGQWTHDPSEPIVTSQLGTVNNIIQVKKTDFEVF 163
               SCOP domains d1z0ma1 A:77-163 5'-AMP-activated protein kinase subunit beta-1                         SCOP domains
               CATH domains --------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeee......eeeee.hhh...ee.eee..eeeeeeee..eeeeeeeee..eee......eee.....eeeeeee.....eee Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.2  PDB: A:77-108         -------------------------------Exon 1.4  PDB: A:140-163 Transcript 1 (1)
           Transcript 1 (2) -------------------------------Exon 1.3  PDB: A:108-139        ------------------------ Transcript 1 (2)
                 1z0m A  77 ARPTVFRWTGGGKEVYLSGSFNNWSKLPLTRSQNNFVAILDLPEGEHQYKFFVDGQWTHDPSEPIVTSQLGTVNNIIQVKKTDFEVF 163
                                    86        96       106       116       126       136       146       156

Chain B from PDB  Type:PROTEIN  Length:81
 aligned with AAKB1_RAT | P80386 from UniProtKB/Swiss-Prot  Length:270

    Alignment length:81
                                    85        95       105       115       125       135       145       155 
            AAKB1_RAT    76 QARPTVFRWTGGGKEVYLSGSFNNWSKLPLTRSQNNFVAILDLPEGEHQYKFFVDGQWTHDPSEPIVTSQLGTVNNIIQVK 156
               SCOP domains d1z0mb_ B: automated matches                                                      SCOP domains
               CATH domains --------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeeee......eeeee.hhh...ee.eee..eeeeeeeee.eeeeeeeee..eee......eee.....eeeeeee. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.2  PDB: B:76-108          -------------------------------Exon 1.4          Transcript 1 (1)
           Transcript 1 (2) --------------------------------Exon 1.3  PDB: B:108-139        ----------------- Transcript 1 (2)
                 1z0m B  76 QARPTVFRWTGGGKEVYLSGSFNNWSKLPLTRSQNNFVAILDLPEGEHQYKFFVDGQWTHDPSEPIVTSQLGTVNNIIQVK 156
                                    85        95       105       115       125       135       145       155

Chain C from PDB  Type:PROTEIN  Length:80
 aligned with AAKB1_RAT | P80386 from UniProtKB/Swiss-Prot  Length:270

    Alignment length:80
                                    86        96       106       116       126       136       146       156
            AAKB1_RAT    77 ARPTVFRWTGGGKEVYLSGSFNNWSKLPLTRSQNNFVAILDLPEGEHQYKFFVDGQWTHDPSEPIVTSQLGTVNNIIQVK 156
               SCOP domains d1z0mc_ C: automated matches                                                     SCOP domains
               CATH domains -------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) -------------------------------------------------------------------------AMPKBI- Pfam domains (1)
           Pfam domains (2) -------------------------------------------------------------------------AMPKBI- Pfam domains (2)
           Pfam domains (3) -------------------------------------------------------------------------AMPKBI- Pfam domains (3)
         Sec.struct. author .eeeeeee......eeeee.hhh...ee.eee..eeeeeeee..eeeeeeeee..eee......eee.....eeeeeee. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.2  PDB: C:77-108         -------------------------------Exon 1.4          Transcript 1 (1)
           Transcript 1 (2) -------------------------------Exon 1.3  PDB: C:108-139        ----------------- Transcript 1 (2)
                 1z0m C  77 ARPTVFRWTGGGKEVYLSGSFNNWSKLPLTRSQNNFVAILDLPEGEHQYKFFVDGQWTHDPSEPIVTSQLGTVNNIIQVK 156
                                    86        96       106       116       126       136       146       156

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (2, 3)

CATH Domains (0, 0)

Pfam Domains (1, 3)

Gene Ontology (16, 16)

Asymmetric Unit(hide GO term definitions)

Chain A,B,C (AAKB1_RAT | P80386)

molecular function
	GO:0004679	AMP-activated protein kinase activity	Catalysis of the reaction: ATP + a protein = ADP + a phosphoprotein. This reaction requires the presence of AMP.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0004672	protein kinase activity	Catalysis of the phosphorylation of an amino acid residue in a protein, usually according to the reaction: a protein + ATP = a phosphoprotein + ADP.
	GO:0019901	protein kinase binding	Interacting selectively and non-covalently with a protein kinase, any enzyme that catalyzes the transfer of a phosphate group, usually from ATP, to a protein substrate.
biological process
	GO:0006633	fatty acid biosynthetic process	The chemical reactions and pathways resulting in the formation of a fatty acid, any of the aliphatic monocarboxylic acids that can be liberated by hydrolysis from naturally occurring fats and oils. Fatty acids are predominantly straight-chain acids of 4 to 24 carbon atoms, which may be saturated or unsaturated; branched fatty acids and hydroxy fatty acids also occur, and very long chain acids of over 30 carbons are found in waxes.
	GO:0006631	fatty acid metabolic process	The chemical reactions and pathways involving fatty acids, aliphatic monocarboxylic acids liberated from naturally occurring fats and oils by hydrolysis.
	GO:0006629	lipid metabolic process	The chemical reactions and pathways involving lipids, compounds soluble in an organic solvent but not, or sparingly, in an aqueous solvent. Includes fatty acids; neutral fats, other fatty-acid esters, and soaps; long-chain (fatty) alcohols and waxes; sphingoids and other long-chain bases; glycolipids, phospholipids and sphingolipids; and carotenes, polyprenols, sterols, terpenes and other isoprenoids.
	GO:0010628	positive regulation of gene expression	Any process that increases the frequency, rate or extent of gene expression. Gene expression is the process in which a gene's coding sequence is converted into a mature gene product or products (proteins or RNA). This includes the production of an RNA transcript as well as any processing to produce a mature RNA product or an mRNA or circRNA (for protein-coding genes) and the translation of that mRNA or circRNA into protein. Protein maturation is included when required to form an active form of a product from an inactive precursor form.
	GO:0051291	protein heterooligomerization	The process of creating protein oligomers, compounds composed of a small number, usually between three and ten, of component monomers that are not all identical. Oligomers may be formed by the polymerization of a number of monomers or the depolymerization of a large protein polymer.
	GO:0006468	protein phosphorylation	The process of introducing a phosphate group on to a protein.
	GO:0050790	regulation of catalytic activity	Any process that modulates the activity of an enzyme.
	GO:0045859	regulation of protein kinase activity	Any process that modulates the frequency, rate or extent of protein kinase activity.
	GO:0007165	signal transduction	The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
cellular component
	GO:0031588	nucleotide-activated protein kinase complex	A protein complex that possesses nucleotide-dependent protein kinase activity. The nucleotide can be AMP (in S. pombe and human) or ADP (in S. cerevisiae).
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
	GO:0043234	protein complex	A stable macromolecular complex composed (only) of two or more polypeptide subunits along with any covalently attached molecules (such as lipid anchors or oligosaccharide) or non-protein prosthetic groups (such as nucleotides or metal ions). Prosthetic group in this context refers to a tightly bound cofactor. The component polypeptide subunits may be identical.

Visualization

Interactive Views

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		BCD	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1z0m)

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]
		Biological Unit 3	[ Jena3D ]

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	1z0m
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	AAKB1_RAT \| P80386
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 3)

Sites (3, 3)