|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (3, 12)| Asymmetric/Biological Unit (3, 12) |
Sites (2, 2)
Asymmetric Unit (2, 2)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1YYV) |
Cis Peptide Bonds (2, 2)
Asymmetric/Biological Unit
|
||||||||||||
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1YYV) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1YYV) |
Exons (0, 0)| (no "Exon" information available for 1YYV) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:114 aligned with Q7CP90_SALTY | Q7CP90 from UniProtKB/TrEMBL Length:128 Alignment length:114 18 28 38 48 58 68 78 88 98 108 118 Q7CP90_SALTY 9 QLREGNLFAEQCPSREVLKHVTSRWGVLILVALRDGTHRFSDLRRKMGGVSEKMLAQSLQALEQDGFLNRVSYPVVPPHVEYSLTPLGEQVSDKVAALADWIELNLPQVLAQRE 122 SCOP domains d1yyva1 A:9-122 Putative transcriptional regulator YtfH SCOP domains CATH domains 1yyvA00 A:9-122 'winged helix' repressor DNA binding domain CATH domains Pfam domains ------------------------------------------------------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------------------------------------------------------------ Transcript 1yyv A 9 QLREGNLFAEQCPSREVLKHVTSRWGVLILVALRDGTHRFSDLRRkmGGVSEkmLAQSLQALEQDGFLNRVSYPVVPPHVEYSLTPLGEQVSDkVAALADWIELNLPQVLAQRE 122 18 28 38 48 || 58 || 68 78 88 98 | 108 118 54-MLY || 102-MLY 55-MSE || 61-MLY 62-MSE Chain B from PDB Type:PROTEIN Length:112 aligned with Q7CP90_SALTY | Q7CP90 from UniProtKB/TrEMBL Length:128 Alignment length:112 21 31 41 51 61 71 81 91 101 111 121 Q7CP90_SALTY 12 EGNLFAEQCPSREVLKHVTSRWGVLILVALRDGTHRFSDLRRKMGGVSEKMLAQSLQALEQDGFLNRVSYPVVPPHVEYSLTPLGEQVSDKVAALADWIELNLPQVLAQRER 123 SCOP domains d1yyvb_ B: Putative transcriptional regulator YtfH SCOP domains CATH domains 1yyvB00 B:12-123 'winged helix' repressor DNA binding domain CATH domains Pfam domains (1) ----------------HxlR-1yyvB01 B:28-118 ----- Pfam domains (1) Pfam domains (2) ----------------HxlR-1yyvB02 B:28-118 ----- Pfam domains (2) SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------------------------------------------------------------- PROSITE Transcript ---------------------------------------------------------------------------------------------------------------- Transcript 1yyv B 12 EGNLFAEQCPSREVLKHVTSRWGVLILVALRDGTHRFSDLRRkmGGVSEkmLAQSLQALEQDGFLNRVSYPVVPPHVEYSLTPLGEQVSDkVAALADWIELNLPQVLAQRER 123 21 31 41 51 || 61| 71 81 91 101| 111 121 54-MLY || 102-MLY 55-MSE || 61-MLY 62-MSE
|
||||||||||||||||||||
SCOP Domains (1, 2)| Asymmetric/Biological Unit |
CATH Domains (1, 2)| Asymmetric/Biological Unit |
Pfam Domains (1, 2)
Asymmetric/Biological Unit
|
Gene Ontology (0, 0)|
Asymmetric/Biological Unit(hide GO term definitions)
(no "Gene Ontology" information available for 1YYV)
|
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|