Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF STRINGENT STARVATION PROTEIN A (SSPA), AN RNA POLYMERASE-ASSOCIATED TRANSCRIPTION FACTOR
 
Authors :  A. -M. Hansen, Y. Gu, M. Li, M. Andrykovitch, D. S. Waugh, D. J. Jin, X. Ji
Date :  23 Feb 05  (Deposition) - 01 Mar 05  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.02
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Gst Fold, Transcription (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  A. -M. Hansen, Y. Gu, M. Li, M. Andrykovitch, D. S. Waugh, D. J. Jin, X. Ji
Structural Basis For The Function Of Stringent Starvation Protein A As A Transcription Factor
J. Biol. Chem. V. 280 17380 2005
PubMed-ID: 15735307  |  Reference-DOI: 10.1074/JBC.M501444200
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - STRINGENT STARVATION PROTEIN A
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI BL21
    Expression System Plasmid: RIL
    Expression System Strain: BL21
    Expression System Taxid: 511693
    Expression System Vector Type: PLASMID
    Gene: SSPA
    Organism Scientific: YERSINIA PESTIS
    Organism Taxid: 632
    Synonym: SSPA

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 2)

Asymmetric/Biological Unit (1, 2)
No.NameCountTypeFull Name
1CIT2Ligand/IonCITRIC ACID

(-) Sites  (2, 2)

Asymmetric Unit (2, 2)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREPRO B:169 , MET B:207 , HIS B:208 , LEU B:209 , ARG B:212 , HOH B:581 , HOH B:618 , HOH B:635 , HOH B:670 , HOH B:672 , HOH B:694BINDING SITE FOR RESIDUE CIT B 501
2AC2SOFTWARETYR A:56 , THR A:58 , TYR A:70 , GLU A:71 , HOH A:233 , HIS B:104 , ARG B:105 , HIS B:108 , ASP B:109BINDING SITE FOR RESIDUE CIT B 502

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1YY7)

(-) Cis Peptide Bonds  (4, 4)

Asymmetric/Biological Unit
No.Residues
1Val A:59 -Pro A:60
2His A:85 -Pro A:86
3Val B:59 -Pro B:60
4His B:85 -Pro B:86

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1YY7)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1YY7)

(-) Exons   (0, 0)

(no "Exon" information available for 1YY7)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:206
 aligned with Q7CL96_YERPE | Q7CL96 from UniProtKB/TrEMBL  Length:213

    Alignment length:206
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203      
         Q7CL96_YERPE     4 AANKRSVMTLFSGPTDIFSHQVRIVLAEKGVSVEIEQVEADNLPQDLIDLNPYRTVPTLVDRELTLYESRIIMEYLDERFPHPPLMPVYPVARGSSRLMMHRIEHDWYSLLYKIEQGNAQEAEAARKQLREELLSIAPVFNETPFFMSEEFSLVDCYLAPLLWRLPVLGIEFTGAGSKELKGYMTRVFERDAFLASLTEAEREMHL 209
               SCOP domains d1yy7a1 A:4-87 automated matches                                                    d1yy7a2 A:88-209 automated matches                                                                                         SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhh..eeeee...hhhhhhhhhhhhhhh..eeeee......hhhhhhhh......eeee..eeeehhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhh........hhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1yy7 A   4 AANKRSVMTLFSGPTDIFSHQVRIVLAEKGVSVEIEQVEADNLPQDLIDLNPYRTVPTLVDRELTLYESRIIMEYLDERFPHPPLMPVYPVARGSSRLMMHRIEHDWYSLLYKIEQGNAQEAEAARKQLREELLSIAPVFNETPFFMSEEFSLVDCYLAPLLWRLPVLGIEFTGAGSKELKGYMTRVFERDAFLASLTEAEREMHL 209
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203      


Chain B from PDB  Type:PROTEIN  Length:204
 aligned with Q7CL96_YERPE | Q7CL96 from UniProtKB/TrEMBL  Length:213

    Alignment length:204
                                    19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209    
         Q7CL96_YERPE    10 VMTLFSGPTDIFSHQVRIVLAEKGVSVEIEQVEADNLPQDLIDLNPYRTVPTLVDRELTLYESRIIMEYLDERFPHPPLMPVYPVARGSSRLMMHRIEHDWYSLLYKIEQGNAQEAEAARKQLREELLSIAPVFNETPFFMSEEFSLVDCYLAPLLWRLPVLGIEFTGAGSKELKGYMTRVFERDAFLASLTEAEREMHLKTRS 213
               SCOP domains d1yy7b1 B:10-87 automated matches                                             d1yy7b2 B:88-213 automated matches                                                                                             SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
           Pfam domains (1) ---GST_N_3-1yy7B03 B:13-87                                                    --------------GST_C-1yy7B01 B:102-194                                                                      ------------------- Pfam domains (1)
           Pfam domains (2) ---GST_N_3-1yy7B04 B:13-87                                                    --------------GST_C-1yy7B02 B:102-194                                                                      ------------------- Pfam domains (2)
         Sec.struct. author .eeeee...hhhhhhhhhhhhhhh...eeee......hhhhh.........eeee..eeeehhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhh....... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 1yy7 B  10 VMTLFSGPTDIFSHQVRIVLAEKGVSVEIEQVEADNLPQDLIDLNPYRTVPTLVDRELTLYESRIIMEYLDERFPHPPLMPVYPVARGSSRLMMHRIEHDWYSLLYKIEQGNAQEAEAARKQLREELLSIAPVFNETPFFMSEEFSLVDCYLAPLLWRLPVLGIEFTGAGSKELKGYMTRVFERDAFLASLTEAEREMHLKTRS 213
                                    19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 4)

Asymmetric/Biological Unit
(-)
Class: All alpha proteins (14657)
(-)
Class: Alpha and beta proteins (a/b) (23833)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 1YY7)

(-) Pfam Domains  (2, 4)

Asymmetric/Biological Unit
(-)
Clan: GST_C (118)
(-)
Family: GST_C (102)
(-)
Yersinia pestis (1)
1aGST_C-1yy7B01B:102-194
1bGST_C-1yy7B02B:102-194
(-)
Clan: Thioredoxin (367)

(-) Gene Ontology  (4, 4)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (Q7CL96_YERPE | Q7CL96)
molecular function
    GO:0001000    bacterial-type RNA polymerase core enzyme binding    Interacting selectively and non-covalently with the bacterial-type RNA polymerase core enzyme, typically consisting of two alpha, one beta, one beta prime, and one omega subunit.
    GO:0004364    glutathione transferase activity    Catalysis of the reaction: R-X + glutathione = H-X + R-S-glutathione. R may be an aliphatic, aromatic or heterocyclic group; X may be a sulfate, nitrile or halide group.
biological process
    GO:0006749    glutathione metabolic process    The chemical reactions and pathways involving glutathione, the tripeptide glutamylcysteinylglycine, which acts as a coenzyme for some enzymes and as an antioxidant in the protection of sulfhydryl groups in enzymes and other proteins; it has a specific role in the reduction of hydrogen peroxide (H2O2) and oxidized ascorbate, and it participates in the gamma-glutamyl cycle.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    CIT  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    His A:85 - Pro A:86   [ RasMol ]  
    His B:85 - Pro B:86   [ RasMol ]  
    Val A:59 - Pro A:60   [ RasMol ]  
    Val B:59 - Pro B:60   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1yy7
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q7CL96_YERPE | Q7CL96
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q7CL96_YERPE | Q7CL96
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1YY7)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1YY7)