1YTQ - JenaLib

Title :   STRUCTURE OF NATIVE HUMAN BETA B2 CRYSTALLIN

Authors :   C. Slingsby, M. A. Smith, O. A. Bateman

Date :   10 Feb 05 (Deposition) - 31 Jan 06 (Release) - 26 Jun 13 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.70

Chains :   Asym. Unit : A
Biol. Unit 1: A  (1x)
Biol. Unit 2: A  (2x)
Biol. Unit 3: A  (4x)

Keywords :   Crystallin, Domain Swapping, Greek Key, Structural Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   M. A. Smith, O. A. Bateman, R. Jaenicke, C. Slingsby
Mutation Of Interfaces In Domain-Swapped Human Betab2-Crystallin
Protein Sci. V. 16 615 2007
PubMed-ID: 17327390 | Reference-DOI: 10.1110/PS.062659107

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (1, 1)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (1, 1)

Asymmetric Unit (1, 1)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_038431	A	65	S	CRBB2_HUMAN	Polymorphism	16986560	A	A	64	S

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (1, 1)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_038431	A	65	S	CRBB2_HUMAN	Polymorphism	16986560	A	A	64	S

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 2 (1, 2)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_038431	A	65	S	CRBB2_HUMAN	Polymorphism	16986560	A	A	64	S

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 3 (1, 4)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_038431	A	65	S	CRBB2_HUMAN	Polymorphism	16986560	A	A	64	S

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

PROSITE Motifs (1, 4)

Asymmetric Unit (1, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	CRYSTALLIN_BETA_GAMMA	PS50915	Crystallins beta and gamma 'Greek key' motif profile.	CRBB2_HUMAN	17-56 57-101 107-148 149-191	4	A:16-55 A:56-100 A:106-147 A:148-190

Biological Unit 1 (1, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	CRYSTALLIN_BETA_GAMMA	PS50915	Crystallins beta and gamma 'Greek key' motif profile.	CRBB2_HUMAN	17-56 57-101 107-148 149-191	4	A:16-55 A:56-100 A:106-147 A:148-190

Biological Unit 2 (1, 8)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	CRYSTALLIN_BETA_GAMMA	PS50915	Crystallins beta and gamma 'Greek key' motif profile.	CRBB2_HUMAN	17-56 57-101 107-148 149-191	8	A:16-55 A:56-100 A:106-147 A:148-190

Biological Unit 3 (1, 16)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	CRYSTALLIN_BETA_GAMMA	PS50915	Crystallins beta and gamma 'Greek key' motif profile.	CRBB2_HUMAN	17-56 57-101 107-148 149-191	16	A:16-55 A:56-100 A:106-147 A:148-190

Exons (5, 5)

Asymmetric Unit (5, 5)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1	ENST00000398215	1	ENSE00001532164	chr22:25615489-25615633	145	CRBB2_HUMAN	-	0	0	-	-
1.2a	ENST00000398215	2a	ENSE00001532163	chr22:25617371-25617450	80	CRBB2_HUMAN	1-18	18	1	A:14-17	4
1.3	ENST00000398215	3	ENSE00000651772	chr22:25620885-25621003	119	CRBB2_HUMAN	19-58	40	1	A:18-57	40
1.4	ENST00000398215	4	ENSE00000651773	chr22:25623820-25623952	133	CRBB2_HUMAN	58-102	45	1	A:57-101	45
1.5	ENST00000398215	5	ENSE00000651774	chr22:25625403-25625545	143	CRBB2_HUMAN	103-150	48	1	A:102-149	48
1.6b	ENST00000398215	6b	ENSE00001725060	chr22:25627571-25627836	266	CRBB2_HUMAN	150-205	56	1	A:149-194	46

Sequences/Alignments

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:181
 aligned with CRBB2_HUMAN | P43320 from UniProtKB/Swiss-Prot  Length:205

    Alignment length:181
                                    24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194 
          CRBB2_HUMAN    15 LNPKIIIFEQENFQGHSHELNGPCPNLKETGVEKAGSVLVQAGPWVGYEQANCKGEQFVFEKGEYPRWDSWTSSRRTDSLSSLRPIKVDSQEHKIILYENPNFTGKKMEIIDDDVPSFHAHGYQEKVSSVRVQSGTWVGYQYPGYRGLQYLLEKGDYKDSSDFGAPHPQVQSVRRIRDMQW 195
               SCOP domains d1ytqa1 A:14-102 beta-Crystallin                                                         d1ytqa2 A:103-194 beta-Crystallin                                                            SCOP domains
               CATH domains --1ytqA01 A:16-101 Crystallins                                                          1ytqA02 A:102-193 Crystallins                                                               - CATH domains
           Pfam domains (1) ---------------------------------------------------------------------------------------------Crystall-1ytqA01 A:107-189                                                         ----- Pfam domains (1)
           Pfam domains (2) ---------------------------------------------------------------------------------------------Crystall-1ytqA02 A:107-189                                                         ----- Pfam domains (2)
         Sec.struct. author ...eeeee........eeee.....hhhhhh.....eeeeee..eeeeee...eeeeeee..eee.hhhhh..........eeee........eeeeeee...eeeeeeee......hhhhh......eeee....eeeeee...eeeeeee..eee.hhhhhh.......eeee...... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------S---------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --CRYSTALLIN_BETA_GAMMA  PDB: A:16-55     CRYSTALLIN_BETA_GAMMA  PDB: A:56-100         -----CRYSTALLIN_BETA_GAMMA  PDB: A:106-147     CRYSTALLIN_BETA_GAMMA  PDB: A:148-190      ---- PROSITE
           Transcript 1 (1) 1.2aExon 1.3  PDB: A:18-57 UniProt: 19-58   --------------------------------------------Exon 1.5  PDB: A:102-149 UniProt: 103-150       --------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) -------------------------------------------Exon 1.4  PDB: A:57-101 UniProt: 58-102      -----------------------------------------------Exon 1.6b  PDB: A:149-194 UniProt: 150-205     Transcript 1 (2)
                 1ytq A  14 LNPKIIIFEQENFQGHSHELNGPCPNLKETGVEKAGSVLVQAGPWVGYEQANCKGEQFVFEKGEYPRWDSWTSSRRTDSLSSLRPIKVDSQEHKIILYENPNFTGKKMEIIDDDVPSFHAHGYQEKVSSVRVQSGTWVGYQYPGYRGLQYLLEKGDYKDSSDFGAPHPQVQSVRRIRDMQW 194
                                    23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 2)

CATH Domains (1, 2)

Pfam Domains (1, 2)

Gene Ontology (7, 7)

Asymmetric Unit(hide GO term definitions)

Chain A (CRBB2_HUMAN | P43320)

molecular function
	GO:0042802	identical protein binding	Interacting selectively and non-covalently with an identical protein or proteins.
	GO:0042803	protein homodimerization activity	Interacting selectively and non-covalently with an identical protein to form a homodimer.
	GO:0005212	structural constituent of eye lens	The action of a molecule that contributes to the structural integrity of the lens of an eye.
	GO:0005198	structural molecule activity	The action of a molecule that contributes to the structural integrity of a complex or its assembly within or outside a cell.
biological process
	GO:0043010	camera-type eye development	The process whose specific outcome is the progression of the camera-type eye over time, from its formation to the mature structure. The camera-type eye is an organ of sight that receives light through an aperture and focuses it through a lens, projecting it on a photoreceptor field.
	GO:0050896	response to stimulus	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus. The process begins with detection of the stimulus and ends with a change in state or activity or the cell or organism.
	GO:0007601	visual perception	The series of events required for an organism to receive a visual stimulus, convert it to a molecular signal, and recognize and characterize the signal. Visual stimuli are detected in the form of photons and are processed to form an image.

Visualization

Interactive Views

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1ytq)

	Sites
(no "Sites" information available for 1ytq)

	Cis Peptide Bonds
		Gly A:56 - Pro A:57	[ RasMol ]

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]
		Biological Unit 3	[ Jena3D ]

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	1ytq
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	CRBB2_HUMAN \| P43320
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Description