![]() |
|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
(no "Ligand,Modified Residues,Ions" information available for 1YHA) |
(no "Site" information available for 1YHA) |
(no "SS Bond" information available for 1YHA) |
(no "Cis Peptide Bond" information available for 1YHA) |
(no "SAP(SNP)/Variant" information available for 1YHA) |
(no "PROSITE Motif" information available for 1YHA) |
(no "Exon" information available for 1YHA) |
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:87 aligned with G5P_BPF1 | P69543 from UniProtKB/Swiss-Prot Length:87 Alignment length:87 10 20 30 40 50 60 70 80 G5P_BPF1 1 MIKVEIKPSQAQFTTRSGVSRQGKPYSLNEQLCYVDLGNEYPVLVKITLDEGQPAYAPGLYTVHLSSFKVGQFGSLMIDRLRLVPAK 87 SCOP domains d1yhaa_ A: Gene V protein SCOP domains CATH domains 1yhaA00 A:1-87 Nucleic acid-binding proteins CATH domains Pfam domains --------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------------------------------------- PROSITE Transcript --------------------------------------------------------------------------------------- Transcript 1yha A 1 MIKVEIKPSQAQFTTRSGVSRQGKPYSLNEQLCYVDLGNEHPVLVKITLDEGQPAYAPGLYTVHLSSFKVGQFGSLMIDRLRLVPAK 87 10 20 30 40 50 60 70 80 Chain B from PDB Type:PROTEIN Length:87 aligned with G5P_BPF1 | P69543 from UniProtKB/Swiss-Prot Length:87 Alignment length:87 10 20 30 40 50 60 70 80 G5P_BPF1 1 MIKVEIKPSQAQFTTRSGVSRQGKPYSLNEQLCYVDLGNEYPVLVKITLDEGQPAYAPGLYTVHLSSFKVGQFGSLMIDRLRLVPAK 87 SCOP domains d1yhab_ B: Gene V protein SCOP domains CATH domains 1yhaB00 B:1-87 Nucleic acid-binding proteins CATH domains Pfam domains (1) -Phage_DNA_bind-1yhaB01 B:2-87 Pfam domains (1) Pfam domains (2) -Phage_DNA_bind-1yhaB02 B:2-87 Pfam domains (2) SAPs(SNPs) --------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------------------------------------- PROSITE Transcript --------------------------------------------------------------------------------------- Transcript 1yha B 1 MIKVEIKPSQAQFTTRSGVSRQGKPYSLNEQLCYVDLGNEHPVLVKITLDEGQPAYAPGLYTVHLSSFKVGQFGSLMIDRLRLVPAK 87 10 20 30 40 50 60 70 80
|
Asymmetric/Biological Unit |
Asymmetric/Biological Unit |
Asymmetric/Biological Unit
|
Asymmetric/Biological Unit(hide GO term definitions) Chain A,B (G5P_BPF1 | P69543)
|
|
|
|
|
|
|