1YG0 - JenaLib

Title :   SOLUTION STRUCTURE OF APO-COPP FROM HELICOBACTER PYLORI

Authors :   B. J. Lee, S. J. Park

Date :   04 Jan 05 (Deposition) - 24 Jan 06 (Release) - 13 Jul 11 (Revision)

Method :   SOLUTION NMR

Resolution :   NOT APPLICABLE

Chains :   NMR Structure  : A
NMR Structure *: A  (1x)

Keywords :   Open-Faced Beta-Sandwich, Missing C-Terminal Beta-Sheet, Metal Transport (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   B. J. Lee, S. J. Park
Solution Structure Of Apo-Copp From Helicobacter Pylori
To Be Published
PubMed: search

Compounds

Molecule 1 - COP ASSOCIATED PROTEIN
	Chains	:	A
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PGEX-4T-1
	Expression System Strain	:	DH5A
	Expression System Taxid	:	562
	Expression System Vector Type	:	PLASMID
	Gene	:	COPP
	Organism Scientific	:	HELICOBACTER PYLORI
	Organism Taxid	:	85962
	Strain	:	26695
	Synonym	:	HPCOPP, COPPER ION BINDING PROTEIN

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (6, 6)

NMR Structure (6, 6)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_COPP_HELPY_001 *	A	3	V	COPP_HELPY	---	---	A	A	3	V
2	UniProt	VAR_COPP_HELPY_002 *	N	13	D	COPP_HELPY	---	---	A	N	13	D
3	UniProt	VAR_COPP_HELPY_003 *	N	13	S	COPP_HELPY	---	---	A	N	13	S
4	UniProt	VAR_COPP_HELPY_004 *	V	34	A	COPP_HELPY	---	---	A	V	34	A
5	UniProt	VAR_COPP_HELPY_005 *	S	35	N	COPP_HELPY	---	---	A	S	35	N
6	UniProt	VAR_COPP_HELPY_006 *	V	66	I	COPP_HELPY	---	---	A	V	66	I
	* ID not provided by source

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

NMR Structure * (6, 6)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_COPP_HELPY_001 *	A	3	V	COPP_HELPY	---	---	A	A	3	V
2	UniProt	VAR_COPP_HELPY_002 *	N	13	D	COPP_HELPY	---	---	A	N	13	D
3	UniProt	VAR_COPP_HELPY_003 *	N	13	S	COPP_HELPY	---	---	A	N	13	S
4	UniProt	VAR_COPP_HELPY_004 *	V	34	A	COPP_HELPY	---	---	A	V	34	A
5	UniProt	VAR_COPP_HELPY_005 *	S	35	N	COPP_HELPY	---	---	A	S	35	N
6	UniProt	VAR_COPP_HELPY_006 *	V	66	I	COPP_HELPY	---	---	A	V	66	I
	* ID not provided by source

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

PROSITE Motifs (2, 2)

NMR Structure (2, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	HMA_2	PS50846	Heavy-metal-associated domain profile.	COPP_HELPY	2-66	1	A:2-66
2	HMA_1	PS01047	Heavy-metal-associated domain.	COPP_HELPY	7-36	1	A:7-36

NMR Structure * (2, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	HMA_2	PS50846	Heavy-metal-associated domain profile.	COPP_HELPY	2-66	1	A:2-66
2	HMA_1	PS01047	Heavy-metal-associated domain.	COPP_HELPY	7-36	1	A:7-36

Exons (0, 0)

Sequences/Alignments

NMR Structure

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:66
 aligned with COPP_HELPY | Q48271 from UniProtKB/Swiss-Prot  Length:66

    Alignment length:66
                                    10        20        30        40        50        60      
            COPP_HELPY    1 MKATFQVPSITCNHCVDKIEKFVGEIEGVSFIDVSVEKKSVVVEFDAPATQDLIKEALLDAGQEVV 66
               SCOP domains ------------------------------------------------------------------ SCOP domains
               CATH domains 1yg0A00 A:1-66  [code=3.30.70.100, no name defined]                CATH domains
               Pfam domains ---HMA-1yg0A01 A:4-64                                           -- Pfam domains
         Sec.struct. author .eeee.......hhhhhhhhhhhh....eeeeeee....eeeeee....hhhhhhhhhhhhh.... Sec.struct. author
             SAPs(SNPs) (1) --V---------D--------------------AN------------------------------I SAPs(SNPs) (1)
             SAPs(SNPs) (2) ------------S----------------------------------------------------- SAPs(SNPs) (2)
                PROSITE (1) -HMA_2  PDB: A:2-66 UniProt: 2-66                                  PROSITE (1)
                PROSITE (2) ------HMA_1  PDB: A:7-36            ------------------------------ PROSITE (2)
                 Transcript ------------------------------------------------------------------ Transcript
                  1yg0 A  1 MKATFQVPSITCNHCVDKIEKFVGEIEGVSFIDVSVEKKSVVVEFDAPATQDLIKEALLDAGQEVV 66
                                    10        20        30        40        50        60

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (1, 1)

Pfam Domains (1, 1)

Gene Ontology (5, 5)

NMR Structure(hide GO term definitions)

Chain A (COPP_HELPY | Q48271)

molecular function
	GO:0005507	copper ion binding	Interacting selectively and non-covalently with copper (Cu) ions.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0006825	copper ion transport	The directed movement of copper (Cu) ions into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0030001	metal ion transport	The directed movement of metal ions, any metal ion with an electric charge, into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.

Visualization

Interactive Views

NMR Structure
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1yg0)

	Sites
(no "Sites" information available for 1yg0)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1yg0)

Still Images

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ NMR Structure - model 1 PNG format \| NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	1yg0
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	COPP_HELPY \| Q48271
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Analysis Tools

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	COPP_HELPY \| Q48271
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

Description