|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
(no "Ligand,Modified Residues,Ions" information available for 1Y9X) |
(no "Site" information available for 1Y9X) |
(no "SS Bond" information available for 1Y9X) |
(no "Cis Peptide Bond" information available for 1Y9X) |
(no "SAP(SNP)/Variant" information available for 1Y9X) |
(no "PROSITE Motif" information available for 1Y9X) |
(no "Exon" information available for 1Y9X) |
NMR StructureChain A from PDB Type:PROTEIN Length:97 aligned with ALBA1_SULSH | P60848 from UniProtKB/Swiss-Prot Length:97 Alignment length:97 10 20 30 40 50 60 70 80 90 ALBA1_SULSH 1 MSSGTPTPSNVVLIGKKPVMNYVLAALTLLNQGVSEIVIKARGRAISKAVDTVEIVRNRFLPDKIEIKEIRVGSQVVTSQDGRQSRVSTIEIAIRKK 97 SCOP domains d1y9xa_ A: automated matches SCOP domains CATH domains ---------1y9xA01 A:10-97 [code=3.30.110.20, no name defined] CATH domains Pfam domains ------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------- PROSITE Transcript ------------------------------------------------------------------------------------------------- Transcript 1y9x A 1 MSSGTPTPSNVVLIGKKPVMNYVLAALTLLNQGVSEIVIKARGRAISKAVDTVEIVRNRFLADKIEIKEIRVGSQVVTSQDGRQSRVSTIEIAIRKK 97 10 20 30 40 50 60 70 80 90 Chain B from PDB Type:PROTEIN Length:97 aligned with ALBA1_SULSH | P60848 from UniProtKB/Swiss-Prot Length:97 Alignment length:97 10 20 30 40 50 60 70 80 90 ALBA1_SULSH 1 MSSGTPTPSNVVLIGKKPVMNYVLAALTLLNQGVSEIVIKARGRAISKAVDTVEIVRNRFLPDKIEIKEIRVGSQVVTSQDGRQSRVSTIEIAIRKK 97 SCOP domains d1y9xb_ B: automated matches SCOP domains CATH domains ---------1y9xB01 B:10-97 [code=3.30.110.20, no name defined] CATH domains Pfam domains (1) ---------Alba-1y9xB01 B:10-74 ----------------------- Pfam domains (1) Pfam domains (2) ---------Alba-1y9xB02 B:10-74 ----------------------- Pfam domains (2) SAPs(SNPs) ------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------- PROSITE Transcript ------------------------------------------------------------------------------------------------- Transcript 1y9x B 1 MSSGTPTPSNVVLIGKKPVMNYVLAALTLLNQGVSEIVIKARGRAISKAVDTVEIVRNRFLADKIEIKEIRVGSQVVTSQDGRQSRVSTIEIAIRKK 97 10 20 30 40 50 60 70 80 90
|
NMR Structure |
NMR Structure |
NMR Structure |
NMR Structure(hide GO term definitions) Chain A,B (ALBA1_SULSH | P60848)
|
|
|
|
|
|
|