|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 1)
Asymmetric Unit (1, 1)
|
Sites (1, 1)
Asymmetric Unit (1, 1)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1H0Y) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1H0Y) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1H0Y) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1H0Y) |
Exons (0, 0)| (no "Exon" information available for 1H0Y) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:89 aligned with ALBA1_SULSH | P60848 from UniProtKB/Swiss-Prot Length:97 Alignment length:89 18 28 38 48 58 68 78 88 ALBA1_SULSH 9 SNVVLIGKKPVMNYVLAALTLLNQGVSEIVIKARGRAISKAVDTVEIVRNRFLPDKIEIKEIRVGSQVVTSQDGRQSRVSTIEIAIRKK 97 SCOP domains d1h0ya_ A: DNA-binding protein AlbA SCOP domains CATH domains 1h0yA00 A:12-100 [code=3.30.110.20, no name defined] CATH domains Pfam domains ----------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------------------------------- Transcript 1h0y A 12 SNVVLIGKKPVMNYVLAALTLLNQGVSEIVIKARGRAISKAVDTVEIVRNRFLPDKIEIKEIRVGSQVVTSQDGRQSRVSTIEIAIRKK 100 21 31 41 51 61 71 81 91 Chain A from PDB Type:PROTEIN Length:89 aligned with ALBA1_SULSO | P60849 from UniProtKB/Swiss-Prot Length:97 Alignment length:89 18 28 38 48 58 68 78 88 ALBA1_SULSO 9 SNVVLIGKKPVMNYVLAALTLLNQGVSEIVIKARGRAISKAVDTVEIVRNRFLPDKIEIKEIRVGSQVVTSQDGRQSRVSTIEIAIRKK 97 SCOP domains d1h0ya_ A: DNA-binding protein AlbA SCOP domains CATH domains 1h0yA00 A:12-100 [code=3.30.110.20, no name defined] CATH domains Pfam domains ----------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------------------------------- Transcript 1h0y A 12 SNVVLIGKKPVMNYVLAALTLLNQGVSEIVIKARGRAISKAVDTVEIVRNRFLPDKIEIKEIRVGSQVVTSQDGRQSRVSTIEIAIRKK 100 21 31 41 51 61 71 81 91
|
||||||||||||||||||||
SCOP Domains (1, 1)| Asymmetric Unit |
CATH Domains (1, 1)
Asymmetric Unit
|
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 1H0Y) |
Gene Ontology (7, 14)|
Asymmetric Unit(hide GO term definitions) Chain A (ALBA1_SULSH | P60848)
Chain A (ALBA1_SULSO | P60849)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|