![]() |
|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric/Biological Unit (2, 7) |
Asymmetric Unit (1, 1)
|
(no "SS Bond" information available for 1Y0U) |
(no "Cis Peptide Bond" information available for 1Y0U) |
(no "SAP(SNP)/Variant" information available for 1Y0U) |
(no "PROSITE Motif" information available for 1Y0U) |
(no "Exon" information available for 1Y0U) |
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:89 aligned with O30069_ARCFU | O30069 from UniProtKB/TrEMBL Length:92 Alignment length:89 1 | 8 18 28 38 48 58 68 78 O30069_ARCFU - --MSLEEWIKADSLEKADEYHKRYNYAVTNPVRRKILRMLDKGRSEEEIMQTLSLSKKQLDYHLKVLEAGFCIERVGERWVVTDAGKIV 87 SCOP domains d1y0ua_ A: Putative arsenical resistance operon repressor AF0168 SCOP domains CATH domains 1y0uA00 A:-1-87 'winged helix' repressor DNA binding domain CATH domains Pfam domains ----------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------------------------------- Transcript 1y0u A -1 GHmSLEEWIKADSLEKADEYHKRYNYAVTNPVRRKILRmLDKGRSEEEImQTLSLSKKQLDYHLKVLEAGFCIERVGERWVVTDAGKIV 87 | 8 18 28 38 48 58 68 78 | 37-MSE 48-MSE 1-MSE Chain B from PDB Type:PROTEIN Length:88 aligned with O30069_ARCFU | O30069 from UniProtKB/TrEMBL Length:92 Alignment length:88 1 | 8 18 28 38 48 58 68 78 O30069_ARCFU - --MSLEEWIKADSLEKADEYHKRYNYAVTNPVRRKILRMLDKGRSEEEIMQTLSLSKKQLDYHLKVLEAGFCIERVGERWVVTDAGKI 86 SCOP domains d1y0ub_ B: Putative arsenical resistance operon repressor AF0168 SCOP domains CATH domains 1y0uB00 B:-1-86 'winged helix' repressor DNA binding domain CATH domains Pfam domains (1) ---------------------HTH_20-1y0uB01 B:20-78 -------- Pfam domains (1) Pfam domains (2) ---------------------HTH_20-1y0uB02 B:20-78 -------- Pfam domains (2) SAPs(SNPs) ---------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------------------------------------- PROSITE Transcript ---------------------------------------------------------------------------------------- Transcript 1y0u B -1 GHmSLEEWIKADSLEKADEYHKRYNYAVTNPVRRKILRmLDKGRSEEEImQTLSLSKKQLDYHLKVLEAGFCIERVGERWVVTDAGKI 86 | 8 18 28 38 48 58 68 78 1-MSE 37-MSE 48-MSE
|
Asymmetric/Biological Unit
|
Asymmetric/Biological Unit
|
Asymmetric/Biological Unit
|
Asymmetric/Biological Unit(hide GO term definitions)
(no "Gene Ontology" information available for 1Y0U)
|
|
|
|
|
|
|