|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 2)
Asymmetric/Biological Unit (1, 2)
|
Sites (0, 0)| (no "Site" information available for 1Y0K) |
SS Bonds (0, 0)| (no "SS Bond" information available for 1Y0K) |
Cis Peptide Bonds (2, 2)
Asymmetric/Biological Unit
|
||||||||||||
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1Y0K) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1Y0K) |
Exons (0, 0)| (no "Exon" information available for 1Y0K) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:180 aligned with Q9HVP2_PSEAE | Q9HVP2 from UniProtKB/TrEMBL Length:209 Alignment length:209 10 20 30 40 50 60 70 80 90 100 110 120 130 140 150 160 170 180 190 200 Q9HVP2_PSEAE 1 MNEADYLRLLTRQAEQANDFLSNARKWDRERWVCQRFLEALNVPYRQEDFAAPGEQPPDVLFKGAGFEVFFVLDEGRRLNEEWREELTRRRQAVSLRQLIRREERPQRIAAAELQARLAPTLRKKAHNYSERGIDHGELDLLAFVNLKRAVPDFNTPFPPPTEYLRQGWRSLSMVGPTFARVLFAHSGAPEFLRANLGRSILFDAGVGL 209 SCOP domains d1y0ka1 A:1-209 Hypothetical protein PA4535 SCOP domains CATH domains -1y0kA00 A:2-209 Hypothetical protein pa4535 CATH domains Pfam domains -DUF1780-1y0kA01 A:2-209 Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1y0k A 1 mNEADYLRLLTRQAEQANDFLSNARKWDRERWVCQRFLEALNVPYRQEDFAAPGEQPPDVLFKGAGFEVFFVLDE-----------------------------RPQRIAAAELQARLAPTLRKKAHNYSERGIDHGELDLLAFVNLKRAVPDFNTPFPPPTEYLRQGWRSLSmVGPTFARVLFAHSGAPEFLRANLGRSILFDAGVGL 209 | 10 20 30 40 50 60 70 | - - - | 110 120 130 140 150 160 170 | 180 190 200 | 75 105 174-MSE 1-MSE
|
||||||||||||||||||||
SCOP Domains (1, 1)| Asymmetric/Biological Unit |
CATH Domains (1, 1)| Asymmetric/Biological Unit |
Pfam Domains (1, 1)
Asymmetric/Biological Unit
|
Gene Ontology (0, 0)|
Asymmetric/Biological Unit(hide GO term definitions)
(no "Gene Ontology" information available for 1Y0K)
|
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|