![]() |
|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
(no "Ligand,Modified Residues,Ions" information available for 1XSX) |
(no "Site" information available for 1XSX) |
(no "SS Bond" information available for 1XSX) |
(no "Cis Peptide Bond" information available for 1XSX) |
(no "SAP(SNP)/Variant" information available for 1XSX) |
(no "PROSITE Motif" information available for 1XSX) |
(no "Exon" information available for 1XSX) |
NMR StructureChain A from PDB Type:PROTEIN Length:95 aligned with Q5W1E8_SULSF | Q5W1E8 from UniProtKB/TrEMBL Length:96 Alignment length:95 11 21 31 41 51 61 71 81 91 Q5W1E8_SULSF 2 AKKKSKLEIIQAILEACKSGSPKTRIMYGANLSYALTGRYIKMLMDLEIIRQEGKQYMLTKKGEELLEDIRKFNEMRKNMDQLKEKINSVLSIRQ 96 SCOP domains d1xsxa_ A: Sso10a (SSO10449) SCOP domains CATH domains 1xsxA00 A:1-95 'winged helix' repressor DNA binding domain CATH domains Pfam domains ----------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------------------------------------- Transcript 1xsx A 1 AKKKSKLEIIQAILEACKSGSPKTRIMYGANLSYALTGRYIKMLMDLEIIRQEGKQYMLTKKGEELLEDIRKFNEMRKNMDQLKEKINSVLSIRQ 95 10 20 30 40 50 60 70 80 90 Chain B from PDB Type:PROTEIN Length:95 aligned with Q5W1E8_SULSF | Q5W1E8 from UniProtKB/TrEMBL Length:96 Alignment length:95 11 21 31 41 51 61 71 81 91 Q5W1E8_SULSF 2 AKKKSKLEIIQAILEACKSGSPKTRIMYGANLSYALTGRYIKMLMDLEIIRQEGKQYMLTKKGEELLEDIRKFNEMRKNMDQLKEKINSVLSIRQ 96 SCOP domains d1xsxb_ B: Sso10a (SSO10449) SCOP domains CATH domains 1xsxB00 B:1-95 'winged helix' repressor DNA binding domain CATH domains Pfam domains ----------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------------------------------------- Transcript 1xsx B 1 AKKKSKLEIIQAILEACKSGSPKTRIMYGANLSYALTGRYIKMLMDLEIIRQEGKQYMLTKKGEELLEDIRKFNEMRKNMDQLKEKINSVLSIRQ 95 10 20 30 40 50 60 70 80 90
|
NMR Structure
|
NMR Structure |
(no "Pfam Domain" information available for 1XSX) |
NMR Structure(hide GO term definitions) Chain A,B (Q5W1E8_SULSF | Q5W1E8)
|
|
|
|
|
|
|