Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF NORTHEAST STRUCTURAL GENOMICS TARGET SR156
 
Authors :  A. Kuzin, M. Abashidze, S. Vorobiev, F. Forouhar, T. Acton, L. Ma, R. Xiao, G. Montelione, L. Tong, J. Hunt, Northeast Structural Genomics Consortium (Nesg)
Date :  01 Oct 04  (Deposition) - 19 Oct 04  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.80
Chains :  Asym./Biol. Unit :  A,B,C,D
Keywords :  X-Ray Structure, Structural Genomics, Protein Structure Initiative, Psi, Nesg, Northeast Structural Genomics Consortium, Biosynthetic Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  A. Kuzin, M. Abashidze, S. Vorobiev, F. Forouhar, T. Acton, L. Ma, R. Xiao, G. Montelione, L. Tong, J. Hunt
Crystal Structure Of Northeast Structural Genomics Target Sr156
To Be Published
PubMed: search
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - THIAZOLE BIOSYNTHESIS PROTEIN THIG
    Chains: A, B, C, D
    Engineered: YES
    Expression System: ESCHERICHIA COLI BL21(DE3)
    Expression System Plasmid: PET21
    Expression System Strain: BL21(DE3)
    Expression System Taxid: 469008
    Expression System Vector Type: PLASMID
    Gene: THIG
    Organism Scientific: BACILLUS SUBTILIS
    Organism Taxid: 1423

 Structural Features

(-) Chains, Units

  1234
Asymmetric/Biological Unit : ABCD

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 28)

Asymmetric/Biological Unit (1, 28)
No.NameCountTypeFull Name
1MSE28Mod. Amino AcidSELENOMETHIONINE

(-) Sites  (0, 0)

(no "Site" information available for 1XM3)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1XM3)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1XM3)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1XM3)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1XM3)

(-) Exons   (0, 0)

(no "Exon" information available for 1XM3)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:244
 aligned with THIG_BACSU | O31618 from UniProtKB/Swiss-Prot  Length:256

    Alignment length:251
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251 
           THIG_BACSU     2 SMLTIGGKSFQSRLLLGTGKYPSFDIQKEAVAVSESDILTFAVRRMNIFEASQPNFLEQLDLSKYTLLPNTAGASTAEEAVRIARLAKASGLCDMIKVEVIGCSRSLLPDPVETLKASEQLLEEGFIVLPYTSDDVVLARKLEELGVHAIMPGASPIGSGQGILNPLNLSFIIEQAKVPVIVDAGIGSPKDAAYAMELGADGVLLNTAVSGADDPVKMARAMKLAVEAGRLSYEAGRIPLKQYGTASSPGE 252
               SCOP domains d1xm3a_ A: Thiazole biosynthesis protein ThiG                                                                                                                                                                                                               SCOP domains
               CATH domains 1xm3A00 A:2-252 Aldolase class I                                                                                                                                                                                                                            CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eee..eee...eeee.....hhhhhhhhhhhhh..eeeee.......-------....hhhhheeeee.....hhhhhhhhhhhhhhh.....eee...........hhhhhhhhhhhhhhh...eeeee..hhhhhhhhhhh.....ee............hhhhhhhhhhhh....eee....hhhhhhhhhhh...eeeehhhhhh..hhhhhhhhhhhhhhhhhhhhhhh............... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1xm3 A   2 SmLTIGGKSFQSRLLLGTGKYPSFDIQKEAVAVSESDILTFAVRRmNIF-------LEQLDLSKYTLLPNTAGASTAEEAVRIARLAKASGLCDmIKVEVIGCSRSLLPDPVETLKASEQLLEEGFIVLPYTSDDVVLARKLEELGVHAImPGASPIGSGQGILNPLNLSFIIEQAKVPVIVDAGIGSPKDAAYAmELGADGVLLNTAVSGADDPVKmARAmKLAVEAGRLSYEAGRIPLKQYGTASSPGE 252
                             |      11        21        31        41     |  |-      | 61        71        81        91    |  101       111       121       131       141       151|      161       171       181       191     | 201       211       221 |     231       241       251 
                             |                                          47-MSE     58                                    96-MSE                                                 152-MSE                                      197-MSE               219-MSE                             
                             3-MSE                                                                                                                                                                                                                     223-MSE                         


Chain B from PDB  Type:PROTEIN  Length:251
 aligned with THIG_BACSU | O31618 from UniProtKB/Swiss-Prot  Length:256

    Alignment length:251
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251 
           THIG_BACSU     2 SMLTIGGKSFQSRLLLGTGKYPSFDIQKEAVAVSESDILTFAVRRMNIFEASQPNFLEQLDLSKYTLLPNTAGASTAEEAVRIARLAKASGLCDMIKVEVIGCSRSLLPDPVETLKASEQLLEEGFIVLPYTSDDVVLARKLEELGVHAIMPGASPIGSGQGILNPLNLSFIIEQAKVPVIVDAGIGSPKDAAYAMELGADGVLLNTAVSGADDPVKMARAMKLAVEAGRLSYEAGRIPLKQYGTASSPGE 252
               SCOP domains d1xm3b_ B: Thiazole biosynthesis protein ThiG                                                                                                                                                                                                               SCOP domains
               CATH domains 1xm3B00 B:2-252 Aldolase class I                                                                                                                                                                                                                            CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eee..eee...eeee.....hhhhhhhhhhhhh..eeeee.hhh..............hhhhheeeee.....hhhhhhhhhhhhhhh.....eee...........hhhhhhhhhhhhhhh...eeeee..hhhhhhhhhhh.....ee............hhhhhhhhhhhh....eee....hhhhhhhhhhh...eeeehhhhhh..hhhhhhhhhhhhhhhhhhhhhhh............... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1xm3 B   2 SmLTIGGKSFQSRLLLGTGKYPSFDIQKEAVAVSESDILTFAVRRmNIFEASQPNFLEQLDLSKYTLLPNTAGASTAEEAVRIARLAKASGLCDmIKVEVIGCSRSLLPDPVETLKASEQLLEEGFIVLPYTSDDVVLARKLEELGVHAImPGASPIGSGQGILNPLNLSFIIEQAKVPVIVDAGIGSPKDAAYAmELGADGVLLNTAVSGADDPVKmARAmKLAVEAGRLSYEAGRIPLKQYGTASSPGE 252
                             |      11        21        31        41     |  51        61        71        81        91    |  101       111       121       131       141       151|      161       171       181       191     | 201       211       221 |     231       241       251 
                             3-MSE                                      47-MSE                                           96-MSE                                                 152-MSE                                      197-MSE               219-MSE                             
                                                                                                                                                                                                                                                       223-MSE                         


Chain C from PDB  Type:PROTEIN  Length:249
 aligned with THIG_BACSU | O31618 from UniProtKB/Swiss-Prot  Length:256

    Alignment length:249
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241         
           THIG_BACSU     2 SMLTIGGKSFQSRLLLGTGKYPSFDIQKEAVAVSESDILTFAVRRMNIFEASQPNFLEQLDLSKYTLLPNTAGASTAEEAVRIARLAKASGLCDMIKVEVIGCSRSLLPDPVETLKASEQLLEEGFIVLPYTSDDVVLARKLEELGVHAIMPGASPIGSGQGILNPLNLSFIIEQAKVPVIVDAGIGSPKDAAYAMELGADGVLLNTAVSGADDPVKMARAMKLAVEAGRLSYEAGRIPLKQYGTASSP 250
               SCOP domains d1xm3c_ C: Thiazole biosynthesis protein ThiG                                                                                                                                                                                                             SCOP domains
               CATH domains 1xm3C00 C:2-250 Aldolase class I                                                                                                                                                                                                                          CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eee..eee...eeee.....hhhhhhhhhhhhh..eeeee.hhh..............hhhhheeeee.....hhhhhhhhhhhhhhh.....eee...........hhhhhhhhhhhhhhh...eeeee..hhhhhhhhhh......ee............hhhhhhhhhhhh....eee....hhhhhhhhhhh...eeeehhhhhh..hhhhhhhhhhhhhhhhhhhhhhh............. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1xm3 C   2 SmLTIGGKSFQSRLLLGTGKYPSFDIQKEAVAVSESDILTFAVRRmNIFEASQPNFLEQLDLSKYTLLPNTAGASTAEEAVRIARLAKASGLCDmIKVEVIGCSRSLLPDPVETLKASEQLLEEGFIVLPYTSDDVVLARKLEELGVHAImPGASPIGSGQGILNPLNLSFIIEQAKVPVIVDAGIGSPKDAAYAmELGADGVLLNTAVSGADDPVKmARAmKLAVEAGRLSYEAGRIPLKQYGTASSP 250
                             |      11        21        31        41     |  51        61        71        81        91    |  101       111       121       131       141       151|      161       171       181       191     | 201       211       221 |     231       241         
                             3-MSE                                      47-MSE                                           96-MSE                                                 152-MSE                                      197-MSE               219-MSE                           
                                                                                                                                                                                                                                                       223-MSE                       


Chain D from PDB  Type:PROTEIN  Length:249
 aligned with THIG_BACSU | O31618 from UniProtKB/Swiss-Prot  Length:256

    Alignment length:249
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241         
           THIG_BACSU     2 SMLTIGGKSFQSRLLLGTGKYPSFDIQKEAVAVSESDILTFAVRRMNIFEASQPNFLEQLDLSKYTLLPNTAGASTAEEAVRIARLAKASGLCDMIKVEVIGCSRSLLPDPVETLKASEQLLEEGFIVLPYTSDDVVLARKLEELGVHAIMPGASPIGSGQGILNPLNLSFIIEQAKVPVIVDAGIGSPKDAAYAMELGADGVLLNTAVSGADDPVKMARAMKLAVEAGRLSYEAGRIPLKQYGTASSP 250
               SCOP domains d1xm3d_ D: Thiazole biosynthesis protein ThiG                                                                                                                                                                                                             SCOP domains
               CATH domains 1xm3D00 D:2-250 Aldolase class I                                                                                                                                                                                                                          CATH domains
           Pfam domains (1) ---ThiG-1xm3D01 D:5-250                                                                                                                                                                                                                                   Pfam domains (1)
           Pfam domains (2) ---ThiG-1xm3D02 D:5-250                                                                                                                                                                                                                                   Pfam domains (2)
           Pfam domains (3) ---ThiG-1xm3D03 D:5-250                                                                                                                                                                                                                                   Pfam domains (3)
           Pfam domains (4) ---ThiG-1xm3D04 D:5-250                                                                                                                                                                                                                                   Pfam domains (4)
         Sec.struct. author ..eee..eee...eeee.....hhhhhhhhhhhhh..eeeee.hhh..............hhhhheeeee.....hhhhhhhhhhhhhhh.....eee...........hhhhhhhhhhhhhhh...eeeee..hhhhhhhhhh......ee............hhhhhhhhhhhh....eee....hhhhhhhhhhh...eeeehhhhhh..hhhhhhhhhhhhhhhhhhhhhhh............. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1xm3 D   2 SmLTIGGKSFQSRLLLGTGKYPSFDIQKEAVAVSESDILTFAVRRmNIFEASQPNFLEQLDLSKYTLLPNTAGASTAEEAVRIARLAKASGLCDmIKVEVIGCSRSLLPDPVETLKASEQLLEEGFIVLPYTSDDVVLARKLEELGVHAImPGASPIGSGQGILNPLNLSFIIEQAKVPVIVDAGIGSPKDAAYAmELGADGVLLNTAVSGADDPVKmARAmKLAVEAGRLSYEAGRIPLKQYGTASSP 250
                             |      11        21        31        41     |  51        61        71        81        91    |  101       111       121       131       141       151|      161       171       181       191     | 201       211       221 |     231       241         
                             3-MSE                                      47-MSE                                           96-MSE                                                 152-MSE                                      197-MSE               219-MSE                           
                                                                                                                                                                                                                                                       223-MSE
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 4)

Asymmetric/Biological Unit
(-)
Class: Alpha and beta proteins (a/b) (23833)

(-) CATH Domains  (1, 4)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (1, 4)

Asymmetric/Biological Unit
(-)
Clan: TIM_barrel (694)
(-)
Family: ThiG (3)
(-)
Bacillus subtilis (2)
1aThiG-1xm3D01D:5-250
1bThiG-1xm3D02D:5-250
1cThiG-1xm3D03D:5-250
1dThiG-1xm3D04D:5-250

(-) Gene Ontology  (6, 6)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B,C,D   (THIG_BACSU | O31618)
molecular function
    GO:0003824    catalytic activity    Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.
    GO:0016783    sulfurtransferase activity    Catalysis of the transfer of sulfur atoms from one compound (donor) to another (acceptor).
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
    GO:0009228    thiamine biosynthetic process    The chemical reactions and pathways resulting in the formation of thiamine (vitamin B1), a water soluble vitamin present in fresh vegetables and meats, especially liver.
    GO:0009229    thiamine diphosphate biosynthetic process    The chemical reactions and pathways resulting in the formation of thiamine diphosphate, a derivative of thiamine (vitamin B1) which acts as a coenzyme in a range of processes including the Krebs cycle.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
(no "Sites" information available for 1xm3)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1xm3)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1xm3
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  THIG_BACSU | O31618
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  THIG_BACSU | O31618
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        THIG_BACSU | O31618: 1tyg

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1XM3)