1TYG - JenaLib

Biol.Unit 1 - manually (Jmol Viewer)

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Title :   STRUCTURE OF THE THIAZOLE SYNTHASE/THIS COMPLEX

Authors :   E. C. Settembre, P. C. Dorrestein, H. Zhai, A. Chatterjee, F. W. Mclaffe T. P. Begley, S. E. Ealick

Date :   07 Jul 04 (Deposition) - 28 Sep 04 (Release) - 13 Jul 11 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   3.15

Chains :   Asym. Unit : A,B,C,G
Biol. Unit 1: A,B,C,G  (2x)

Keywords :   Alpha Beta Barrel, Protein-Protein Complex, This, Thig, Biosynthetic Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   E. C. Settembre, P. C. Dorrestein, H. Zhai, A. Chatterjee, F. W. Mclafferty, T. P. Begley, S. E. Ealick
Thiamin Biosynthesis In Bacillus Subtilis: Structure Of The Thiazole Synthase/Sulfur Carrier Protein Complex
Biochemistry V. 43 11647 2004
PubMed-ID: 15362849 | Reference-DOI: 10.1021/BI0488911

Molecule 1 - YJBS
	Chains	:	B, G
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PET-16B
	Expression System Taxid	:	562
	Expression System Vector Type	:	PLASMID
	Organism Scientific	:	BACILLUS SUBTILIS
	Organism Taxid	:	1423

Molecule 2 - THIAZOLE BIOSYNTHESIS PROTEIN THIG
	Chains	:	A, C
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PET-16B
	Expression System Taxid	:	562
	Expression System Vector Type	:	PLASMID
	Gene	:	THIG,BSU11690
	Organism Scientific	:	BACILLUS SUBTILIS
	Organism Taxid	:	1423

		1	2	3	4
Asymmetric Unit	:	A	B	C	G
Biological Unit 1 (2x)	:	A	B	C	G

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (1, 2)

No.	Name	Count	Type	Full Name
1	PO4	2	Ligand/Ion	PHOSPHATE ION

Biological Unit 1 (1, 4)

No.	Name	Count	Type	Full Name
1	PO4	4	Ligand/Ion	PHOSPHATE ION

Asymmetric Unit (2, 2)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	ILE A:258 , GLY A:259 , ALA A:285 , GLY A:286 , ASN A:307 , THR A:308	BINDING SITE FOR RESIDUE PO4 A 1400
2	AC2	SOFTWARE	ILE C:258 , ALA C:285 , GLY C:286 , ILE C:287 , LEU C:306 , ASN C:307 , THR C:308	BINDING SITE FOR RESIDUE PO4 C 2400

(no "SS Bond" information available for 1TYG)

(no "Cis Peptide Bond" information available for 1TYG)

(no "SAP(SNP)/Variant" information available for 1TYG)

(no "PROSITE Motif" information available for 1TYG)

(no "Exon" information available for 1TYG)

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:242
 aligned with THIG_BACSU | O31618 from UniProtKB/Swiss-Prot  Length:256

    Alignment length:242
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242  
           THIG_BACSU     3 MLTIGGKSFQSRLLLGTGKYPSFDIQKEAVAVSESDILTFAVRRMNIFEASQPNFLEQLDLSKYTLLPNTAGASTAEEAVRIARLAKASGLCDMIKVEVIGCSRSLLPDPVETLKASEQLLEEGFIVLPYTSDDVVLARKLEELGVHAIMPGASPIGSGQGILNPLNLSFIIEQAKVPVIVDAGIGSPKDAAYAMELGADGVLLNTAVSGADDPVKMARAMKLAVEAGRLSYEAGRIPLKQY 244
               SCOP domains d1tyga_ A: Thiazole biosynthesis protein ThiG                                                                                                                                                                                                      SCOP domains
               CATH domains 1tygA00 A:103-344 Aldolase class I                                                                                                                                                                                                                 CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..ee..ee....eeee.....hhhhhhhhhhhhh...eee.eee.........hhhhhhhhhhh.eee......hhhhhhhhhhhhhhh....eeee...........hhhhhhhhhhhhhhh..eeeeee..hhhhhhhhhh......ee............hhhhhhhhhhhh....eee....hhhhhhhhhhh...eeeehhhhhh..hhhhhhhhhhhhhhhhhhhhhh........ Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1tyg A 103 MLTIGGKSFQSRLLLGTGKYPSFDIQKEAVAVSESDILTFAVRRMNIFEASQPNFLEQLDLSKYTLLPNTAGASTAEEAVRIARLAKASGLCDMIKVEVIGCSRSLLPDPVETLKASEQLLEEGFIVLPYTSDDVVLARKLEELGVHAIMPGASPIGSGQGILNPLNLSFIIEQAKVPVIVDAGIGSPKDAAYAMELGADGVLLNTAVSGADDPVKMARAMKLAVEAGRLSYEAGRIPLKQY 344
                                   112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342

Chain B from PDB  Type:PROTEIN  Length:65
 aligned with THIS_BACSU | O31617 from UniProtKB/Swiss-Prot  Length:66

    Alignment length:65
                                    10        20        30        40        50        60     
           THIS_BACSU     1 MLQLNGKDVKWKKDTGTIQDLLASYQLENKIVIVERNKEIIGKERYHEVELCDRDVIEIVHFVGG  65
               SCOP domains d1tygb_ B: Thiamin biosynthesis sulfur carrier protein ThiS       SCOP domains
               CATH domains 1tygB00 B:1-65  [code=3.10.20.30, no name defined]                CATH domains
               Pfam domains ----------------------------------------------------------------- Pfam domains
         Sec.struct. author .eee..eee.......hhhhhhhhh.......eeee..eeehhhhh.........eeeeeee... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------- Transcript
                 1tyg B   1 MLQLNGKDVKWKKDTGTIQDLLASYQLENKIVIVERNKEIIGKERYHEVELCDRDVIEIVHFVGG  65
                                    10        20        30        40        50        60

Chain C from PDB  Type:PROTEIN  Length:237
 aligned with THIG_BACSU | O31618 from UniProtKB/Swiss-Prot  Length:256

    Alignment length:243
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242   
           THIG_BACSU     3 MLTIGGKSFQSRLLLGTGKYPSFDIQKEAVAVSESDILTFAVRRMNIFEASQPNFLEQLDLSKYTLLPNTAGASTAEEAVRIARLAKASGLCDMIKVEVIGCSRSLLPDPVETLKASEQLLEEGFIVLPYTSDDVVLARKLEELGVHAIMPGASPIGSGQGILNPLNLSFIIEQAKVPVIVDAGIGSPKDAAYAMELGADGVLLNTAVSGADDPVKMARAMKLAVEAGRLSYEAGRIPLKQYG 245
               SCOP domains d1tygc_ C: Thiazole biosynthesis protein       ThiG                                                                                                                                                                                                 SCOP domains
               CATH domains 1tygC00 C:103-345 Aldolase class I                                                                                                                                                                                                                  CATH domains
           Pfam domains (1) --ThiG-1tygC01 C:105-345                                                                                                                                                                                                                            Pfam domains (1)
           Pfam domains (2) --ThiG-1tygC02 C:105-345                                                                                                                                                                                                                            Pfam domains (2)
         Sec.struct. author .eee..eee...eeee.....hhhhhhhhhhhhh...eee.------......hhhhhh.......ee......hhhhhhhhhhhhhhhh....eee...........hhhhhhhhhhhhhhh...eeeee..hhhhhhhhhh......ee..............hhhhhhhhhh....ee.....hhhhhhhhhhh...eeeehhhhhh..hhhhhhhhhhhhhhhhhhhhhh......... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1tyg C 103 MLTIGGKSFQSRLLLGTGKYPSFDIQKEAVAVSESDILTFA------FEASQPNFLEQLDLSKYTLLPNTAGASTAEEAVRIARLAKASGLCDMIKVEVIGCSRSLLPDPVETLKASEQLLEEGFIVLPYTSDDVVLARKLEELGVHAIMPGASPIGSGQGILNPLNLSFIIEQAKVPVIVDAGIGSPKDAAYAMELGADGVLLNTAVSGADDPVKMARAMKLAVEAGRLSYEAGRIPLKQYG 345
                                   112       122       132       142|      152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342   
                                                                  143    150

Chain G from PDB  Type:PROTEIN  Length:64
 aligned with THIS_BACSU | O31617 from UniProtKB/Swiss-Prot  Length:66

    Alignment length:64
                                    10        20        30        40        50        60    
           THIS_BACSU     1 MLQLNGKDVKWKKDTGTIQDLLASYQLENKIVIVERNKEIIGKERYHEVELCDRDVIEIVHFVG  64
               SCOP domains d1tygg_ G: Thiamin biosynthesis sulfur carrier protein ThiS      SCOP domains
               CATH domains 1tygG00 G:1-64  [code=3.10.20.30, no name defined]               CATH domains
           Pfam domains (1) ThiS-1tygG01 G:1-64                                              Pfam domains (1)
           Pfam domains (2) ThiS-1tygG02 G:1-64                                              Pfam domains (2)
         Sec.struct. author .eee..eee.......hhhhhhhh.........ee....eehhhhh.........ee....... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------- Transcript
                 1tyg G   1 MLQLNGKDVKWKKDTGTIQDLLASYQLENKIVIVERNKEIIGKERYHEVELCDRDVIEIVHFVG  64
                                    10        20        30        40        50        60

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: Alpha-Beta Barrel (2994)

Topology: TIM Barrel (2806)

Homologous Superfamily: Aldolase class I (887)

Bacillus subtilis. Organism_taxid: 1423. (4)

1a	1tygA00	A:103-344
1b	1tygC00	C:103-345

Architecture: Roll (3276)

Topology: Ubiquitin-like (UB roll) (674)

Homologous Superfamily: [code=3.10.20.30, no name defined] (153)

Bacillus subtilis. Organism_taxid: 1423. (1)

2a	1tygB00	B:1-65
2b	1tygG00	G:1-64

Asymmetric Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: TIM_barrel (694)

Family: ThiG (3)

Bacillus subtilis (2)

1a	ThiG-1tygC01	C:105-345
1b	ThiG-1tygC02	C:105-345

Clan: Ubiquitin (279)

Family: ThiS (18)

Bacillus subtilis (1)

2a	ThiS-1tygG01	G:1-64
2b	ThiS-1tygG02	G:1-64

Asymmetric Unit(hide GO term definitions)

Chain A,C (THIG_BACSU | O31618)

molecular function
	GO:0003824	catalytic activity	Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.
	GO:0016783	sulfurtransferase activity	Catalysis of the transfer of sulfur atoms from one compound (donor) to another (acceptor).
	GO:0016740	transferase activity	Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
	GO:0009228	thiamine biosynthetic process	The chemical reactions and pathways resulting in the formation of thiamine (vitamin B1), a water soluble vitamin present in fresh vegetables and meats, especially liver.
	GO:0009229	thiamine diphosphate biosynthetic process	The chemical reactions and pathways resulting in the formation of thiamine diphosphate, a derivative of thiamine (vitamin B1) which acts as a coenzyme in a range of processes including the Krebs cycle.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.

Chain B,G (THIS_BACSU | O31617)

molecular function
	GO:0000166	nucleotide binding	Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
biological process
	GO:0009228	thiamine biosynthetic process	The chemical reactions and pathways resulting in the formation of thiamine (vitamin B1), a water soluble vitamin present in fresh vegetables and meats, especially liver.
	GO:0009229	thiamine diphosphate biosynthetic process	The chemical reactions and pathways resulting in the formation of thiamine diphosphate, a derivative of thiamine (vitamin B1) which acts as a coenzyme in a range of processes including the Krebs cycle.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		PO4	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1tyg)

Biological Unit
	Complete Structure
		Biological Unit 1	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1tyg
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	THIG_BACSU \| O31618
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	THIS_BACSU \| O31617
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	THIG_BACSU \| O31618
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	THIS_BACSU \| O31617
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	THIG_BACSU \| O31618	:	1xm3

(no "Related Entries Specified in the PDB File" available for 1TYG)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 2)

Sites (2, 2)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (2, 4)

CATH Domains (2, 4)

Pfam Domains (2, 4)

Gene Ontology (7, 9)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File