1XM2 - JenaLib

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF HUMAN PRL-1

Authors :   D. G. Jeong, S. J. Kim, J. H. Kim, J. H. Son, S. E. Ryu

Date :   01 Oct 04 (Deposition) - 25 Jan 05 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.70

Chains :   Asym. Unit : A,B,C,D,E,F
Biol. Unit 1: A,B,C  (1x)
Biol. Unit 2: D,E,F  (1x)

Keywords :   Hydrolase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   D. G. Jeong, S. J. Kim, J. H. Kim, J. H. Son, M. R. Park, S. M. Lim, T. S. Yoon, S. E. Ryu
Trimeric Structure Of Prl-1 Phosphatase Reveals An Active Enzyme Conformation And Regulation Mechanisms
J. Mol. Biol. V. 345 401 2005
PubMed-ID: 15571731 | Reference-DOI: 10.1016/J.JMB.2004.10.061
(for further references see the PDB file header)

Molecule 1 - TYROSINE PHOSPHATASE
	Chains	:	A, B, C, D, E, F
	EC Number	:	3.1.3.48
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PET28A
	Expression System Taxid	:	562
	Expression System Vector Type	:	PLASMID
	Mutation	:	YES
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	PRL-1

		1	2	3	4	5	6
Asymmetric Unit	:	A	B	C	D	E	F
Biological Unit 1 (1x)	:	A	B	C
Biological Unit 2 (1x)	:				D	E	F

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (2, 24)

No.	Name	Count	Type	Full Name
1	MSE	18	Mod. Amino Acid	SELENOMETHIONINE
2	SO4	6	Ligand/Ion	SULFATE ION

Biological Unit 1 (2, 12)

No.	Name	Count	Type	Full Name
1	MSE	9	Mod. Amino Acid	SELENOMETHIONINE
2	SO4	3	Ligand/Ion	SULFATE ION

Biological Unit 2 (2, 12)

No.	Name	Count	Type	Full Name
1	MSE	9	Mod. Amino Acid	SELENOMETHIONINE
2	SO4	3	Ligand/Ion	SULFATE ION

Asymmetric Unit (6, 6)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	SER A:104 , VAL A:105 , ALA A:106 , GLY A:107 , LEU A:108 , GLY A:109 , ARG A:110 , HOH A:206	BINDING SITE FOR RESIDUE SO4 A 181
2	AC2	SOFTWARE	ASP B:72 , SER B:104 , VAL B:105 , ALA B:106 , GLY B:107 , LEU B:108 , GLY B:109 , ARG B:110	BINDING SITE FOR RESIDUE SO4 B 182
3	AC3	SOFTWARE	SER C:104 , VAL C:105 , ALA C:106 , GLY C:107 , LEU C:108 , GLY C:109 , ARG C:110	BINDING SITE FOR RESIDUE SO4 C 183
4	AC4	SOFTWARE	SER D:104 , ALA D:106 , GLY D:107 , LEU D:108 , GLY D:109 , ARG D:110	BINDING SITE FOR RESIDUE SO4 D 184
5	AC5	SOFTWARE	SER E:104 , VAL E:105 , ALA E:106 , LEU E:108 , GLY E:109 , ARG E:110	BINDING SITE FOR RESIDUE SO4 E 185
6	AC6	SOFTWARE	SER F:104 , VAL F:105 , ALA F:106 , GLY F:107 , LEU F:108 , GLY F:109 , ARG F:110	BINDING SITE FOR RESIDUE SO4 F 186

(no "SS Bond" information available for 1XM2)

Asymmetric Unit

No.	Residues
1	Tyr A:14	-	Lys A:15
2	Tyr B:14	-	Lys B:15
3	Tyr C:14	-	Lys C:15
4	Tyr D:14	-	Lys D:15
5	Tyr E:14	-	Lys E:15
6	Tyr F:14	-	Lys F:15

(no "SAP(SNP)/Variant" information available for 1XM2)

Asymmetric Unit (1, 6)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	TYR_PHOSPHATASE_2	PS50056	Tyrosine specific protein phosphatases family profile.	TP4A1_HUMAN	82-148	6	A:82-148 B:82-148 C:82-148 D:82-148 E:82-148 F:82-148

Biological Unit 1 (1, 3)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	TYR_PHOSPHATASE_2	PS50056	Tyrosine specific protein phosphatases family profile.	TP4A1_HUMAN	82-148	3	A:82-148 B:82-148 C:82-148 - - -

Biological Unit 2 (1, 3)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	TYR_PHOSPHATASE_2	PS50056	Tyrosine specific protein phosphatases family profile.	TP4A1_HUMAN	82-148	3	- - - D:82-148 E:82-148 F:82-148

Asymmetric Unit (5, 30)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.3a	ENST00000370651	3a	ENSE00001860369	chr6:64282394-64282624	231	TP4A1_HUMAN	-	0	0	-	-
1.5c	ENST00000370651	5c	ENSE00000999818	chr6:64286341-64286890	550	TP4A1_HUMAN	1-35	35	6	A:8-35 B:8-35 C:8-35 D:8-35 (gaps) E:8-35 F:8-35 (gaps)	28 28 28 28 28 28
1.6	ENST00000370651	6	ENSE00000757682	chr6:64288342-64288434	93	TP4A1_HUMAN	36-66	31	6	A:36-66 B:36-66 C:36-66 D:36-66 (gaps) E:36-66 F:36-66	31 31 31 31 31 31
1.7	ENST00000370651	7	ENSE00000757684	chr6:64288803-64288933	131	TP4A1_HUMAN	67-110	44	6	A:67-110 B:67-110 C:67-110 D:67-110 E:67-110 F:67-110	44 44 44 44 44 44
1.8	ENST00000370651	8	ENSE00000757686	chr6:64289162-64289236	75	TP4A1_HUMAN	110-135	26	6	A:110-135 B:110-135 C:110-135 D:110-135 E:110-135 F:110-135	26 26 26 26 26 26
1.9c	ENST00000370651	9c	ENSE00001453229	chr6:64289962-64293492	3531	TP4A1_HUMAN	135-173	39	6	A:135-156 B:135-156 C:135-156 D:135-156 E:135-156 F:135-156	22 22 22 22 22 22

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:149
 aligned with TP4A1_HUMAN | Q93096 from UniProtKB/Swiss-Prot  Length:173

    Alignment length:149
                                    17        27        37        47        57        67        77        87        97       107       117       127       137       147         
          TP4A1_HUMAN     8 APVEVTYKNMRFLITHNPTNATLNKFIEELKKYGVTTIVRVCEATYDTTLVEKEGIHVLDWPFDDGAPPSNQIVDDWLSLVKIKFREEPGCCIAVHCVAGLGRAPVLVALALIEGGMKYEDAVQFIRQKRRGAFNSKQLLYLEKYRPKM 156
               SCOP domains d1xm2a_ A: automated matches                                                                                                                          SCOP domains
               CATH domains 1xm2A00 A:8-155 Protein tyrosine phosphatase superfamily                                                                                            - CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeee....eeeee......hhhhhhhhhhhh.eeeeee.......hhhhhhh..eeee.........hhhhhhhhhhhhhhhhhhh...eeeee.....hhhhhhhhhhhhhh..hhhhhhhhhhh......hhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------TYR_PHOSPHATASE_2  PDB: A:82-148 UniProt: 82-148                   -------- PROSITE
           Transcript 1 (1) Exon 1.5c  PDB: A:8-35      Exon 1.6  PDB: A:36-66         Exon 1.7  PDB: A:67-110 UniProt: 67-110     ------------------------Exon 1.9c [INCOMPLETE] Transcript 1 (1)
           Transcript 1 (2) ------------------------------------------------------------------------------------------------------Exon 1.8  PDB: A:110-135  --------------------- Transcript 1 (2)
                 1xm2 A   8 APVEVTYKNmRFLITHNPTNATLNKFIEELKKYGVTTIVRVCEATYDTTLVEKEGIHVLDWPFDDGAPPSNQIVDDWLSLVKIKFREEPGCCIAVHSVAGLGRAPVLVALALIEGGmKYEDAVQFIRQKRRGAFNSKQLLYLEKYRPKm 156
                                    17        27        37        47        57        67        77        87        97       107       117      |127       137       147        |
                                    17-MSE                                                                                                    124-MSE                         156-MSE

Chain B from PDB  Type:PROTEIN  Length:149
 aligned with TP4A1_HUMAN | Q93096 from UniProtKB/Swiss-Prot  Length:173

    Alignment length:149
                                    17        27        37        47        57        67        77        87        97       107       117       127       137       147         
          TP4A1_HUMAN     8 APVEVTYKNMRFLITHNPTNATLNKFIEELKKYGVTTIVRVCEATYDTTLVEKEGIHVLDWPFDDGAPPSNQIVDDWLSLVKIKFREEPGCCIAVHCVAGLGRAPVLVALALIEGGMKYEDAVQFIRQKRRGAFNSKQLLYLEKYRPKM 156
               SCOP domains d1xm2b_ B: automated matches                                                                                                                          SCOP domains
               CATH domains 1xm2B00 B:8-155 Protein tyrosine phosphatase superfamily                                                                                            - CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeee....eeeee......hhhhhhhhhhhh.eeeeee......hhhhhhhh..eeee.........hhhhhhhhhhhhhhhhhhh...eeeee.....hhhhhhhhhhhhhh..hhhhhhhhhhh......hhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------TYR_PHOSPHATASE_2  PDB: B:82-148 UniProt: 82-148                   -------- PROSITE
           Transcript 1 (1) Exon 1.5c  PDB: B:8-35      Exon 1.6  PDB: B:36-66         Exon 1.7  PDB: B:67-110 UniProt: 67-110     ------------------------Exon 1.9c [INCOMPLETE] Transcript 1 (1)
           Transcript 1 (2) ------------------------------------------------------------------------------------------------------Exon 1.8  PDB: B:110-135  --------------------- Transcript 1 (2)
                 1xm2 B   8 APVEVTYKNmRFLITHNPTNATLNKFIEELKKYGVTTIVRVCEATYDTTLVEKEGIHVLDWPFDDGAPPSNQIVDDWLSLVKIKFREEPGCCIAVHSVAGLGRAPVLVALALIEGGmKYEDAVQFIRQKRRGAFNSKQLLYLEKYRPKm 156
                                    17        27        37        47        57        67        77        87        97       107       117      |127       137       147        |
                                    17-MSE                                                                                                    124-MSE                         156-MSE

Chain C from PDB  Type:PROTEIN  Length:149
 aligned with TP4A1_HUMAN | Q93096 from UniProtKB/Swiss-Prot  Length:173

    Alignment length:149
                                    17        27        37        47        57        67        77        87        97       107       117       127       137       147         
          TP4A1_HUMAN     8 APVEVTYKNMRFLITHNPTNATLNKFIEELKKYGVTTIVRVCEATYDTTLVEKEGIHVLDWPFDDGAPPSNQIVDDWLSLVKIKFREEPGCCIAVHCVAGLGRAPVLVALALIEGGMKYEDAVQFIRQKRRGAFNSKQLLYLEKYRPKM 156
               SCOP domains d1xm2c_ C: automated matches                                                                                                                          SCOP domains
               CATH domains 1xm2C00 C:8-155 Protein tyrosine phosphatase superfamily                                                                                            - CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeee....eeeee......hhhhhhhhhhhh.eeeeee......hhhhhhhh..eeee.........hhhhhhhhhhhhhhhhhhh...eeeee.....hhhhhhhhhhhhhh..hhhhhhhhhhh......hhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------TYR_PHOSPHATASE_2  PDB: C:82-148 UniProt: 82-148                   -------- PROSITE
           Transcript 1 (1) Exon 1.5c  PDB: C:8-35      Exon 1.6  PDB: C:36-66         Exon 1.7  PDB: C:67-110 UniProt: 67-110     ------------------------Exon 1.9c [INCOMPLETE] Transcript 1 (1)
           Transcript 1 (2) ------------------------------------------------------------------------------------------------------Exon 1.8  PDB: C:110-135  --------------------- Transcript 1 (2)
                 1xm2 C   8 APVEVTYKNmRFLITHNPTNATLNKFIEELKKYGVTTIVRVCEATYDTTLVEKEGIHVLDWPFDDGAPPSNQIVDDWLSLVKIKFREEPGCCIAVHSVAGLGRAPVLVALALIEGGmKYEDAVQFIRQKRRGAFNSKQLLYLEKYRPKm 156
                                    17        27        37        47        57        67        77        87        97       107       117      |127       137       147        |
                                    17-MSE                                                                                                    124-MSE                         156-MSE

Chain D from PDB  Type:PROTEIN  Length:144
 aligned with TP4A1_HUMAN | Q93096 from UniProtKB/Swiss-Prot  Length:173

    Alignment length:149
                                    17        27        37        47        57        67        77        87        97       107       117       127       137       147         
          TP4A1_HUMAN     8 APVEVTYKNMRFLITHNPTNATLNKFIEELKKYGVTTIVRVCEATYDTTLVEKEGIHVLDWPFDDGAPPSNQIVDDWLSLVKIKFREEPGCCIAVHCVAGLGRAPVLVALALIEGGMKYEDAVQFIRQKRRGAFNSKQLLYLEKYRPKM 156
               SCOP domains d1xm2d_ D: automat  ed matches                                                                                                                        SCOP domains
               CATH domains 1xm2D00 D:8-155 Pr  otein tyrosine phosphat   ase superfamily                                                                                       - CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeee....eeeee...--.hhhhhhhhhhhhheeeeee...---.hhhhhhh..eeee.........hhhhhhhhhhhhhhhhhhh...eeeee.....hhhhhhhhhhhhhh..hhhhhhhhhhh......hhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------TYR_PHOSPHATASE_2  PDB: D:82-148 UniProt: 82-148                   -------- PROSITE
           Transcript 1 (1) Exon 1.5c  PDB: D:8-35 (gapsExon 1.6  PDB: D:36-66 (gaps)  Exon 1.7  PDB: D:67-110 UniProt: 67-110     ------------------------Exon 1.9c [INCOMPLETE] Transcript 1 (1)
           Transcript 1 (2) ------------------------------------------------------------------------------------------------------Exon 1.8  PDB: D:110-135  --------------------- Transcript 1 (2)
                 1xm2 D   8 APVEVTYKNmRFLITHNP--ATLNKFIEELKKYGVTTIVRVCE---DTTLVEKEGIHVLDWPFDDGAPPSNQIVDDWLSLVKIKFREEPGCCIAVHSVAGLGRAPVLVALALIEGGmKYEDAVQFIRQKRRGAFNSKQLLYLEKYRPKm 156
                                    17       | -|       37        47  |   | 57        67        77        87        97       107       117      |127       137       147        |
                                    17-MSE  25 28                    50  54                                                                   124-MSE                         156-MSE

Chain E from PDB  Type:PROTEIN  Length:149
 aligned with TP4A1_HUMAN | Q93096 from UniProtKB/Swiss-Prot  Length:173

    Alignment length:149
                                    17        27        37        47        57        67        77        87        97       107       117       127       137       147         
          TP4A1_HUMAN     8 APVEVTYKNMRFLITHNPTNATLNKFIEELKKYGVTTIVRVCEATYDTTLVEKEGIHVLDWPFDDGAPPSNQIVDDWLSLVKIKFREEPGCCIAVHCVAGLGRAPVLVALALIEGGMKYEDAVQFIRQKRRGAFNSKQLLYLEKYRPKM 156
               SCOP domains d1xm2e_ E: automated matches                                                                                                                          SCOP domains
               CATH domains 1xm2E00 E:8-155 Protein tyrosine phosphatase superfamily                                                                                            - CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eee....eeeee...hhhhhhhhhhhhhhh.eeeeee.......hhhhhhh..eeee.........hhhhhhhhhhhhhhhhhhh...eeeee.....hhhhhhhhhhhhhh..hhhhhhhhhhh......hhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------TYR_PHOSPHATASE_2  PDB: E:82-148 UniProt: 82-148                   -------- PROSITE
           Transcript 1 (1) Exon 1.5c  PDB: E:8-35      Exon 1.6  PDB: E:36-66         Exon 1.7  PDB: E:67-110 UniProt: 67-110     ------------------------Exon 1.9c [INCOMPLETE] Transcript 1 (1)
           Transcript 1 (2) ------------------------------------------------------------------------------------------------------Exon 1.8  PDB: E:110-135  --------------------- Transcript 1 (2)
                 1xm2 E   8 APVEVTYKNmRFLITHNPTNATLNKFIEELKKYGVTTIVRVCEATYDTTLVEKEGIHVLDWPFDDGAPPSNQIVDDWLSLVKIKFREEPGCCIAVHSVAGLGRAPVLVALALIEGGmKYEDAVQFIRQKRRGAFNSKQLLYLEKYRPKm 156
                                    17        27        37        47        57        67        77        87        97       107       117      |127       137       147        |
                                    17-MSE                                                                                                    124-MSE                         156-MSE

Chain F from PDB  Type:PROTEIN  Length:147
 aligned with TP4A1_HUMAN | Q93096 from UniProtKB/Swiss-Prot  Length:173

    Alignment length:149
                                    17        27        37        47        57        67        77        87        97       107       117       127       137       147         
          TP4A1_HUMAN     8 APVEVTYKNMRFLITHNPTNATLNKFIEELKKYGVTTIVRVCEATYDTTLVEKEGIHVLDWPFDDGAPPSNQIVDDWLSLVKIKFREEPGCCIAVHCVAGLGRAPVLVALALIEGGMKYEDAVQFIRQKRRGAFNSKQLLYLEKYRPKM 156
               SCOP domains d1xm2f_ F: automat  ed matches                                                                                                                        SCOP domains
               CATH domains 1xm2F00 F:8-155 Pr  otein tyrosine phosphatase superfamily                                                                                          - CATH domains
           Pfam domains (1) ----------------------------------------------Y_phosphatase-1xm2F01 F:54-152                                                                     ---- Pfam domains (1)
           Pfam domains (2) ----------------------------------------------Y_phosphatase-1xm2F02 F:54-152                                                                     ---- Pfam domains (2)
           Pfam domains (3) ----------------------------------------------Y_phosphatase-1xm2F03 F:54-152                                                                     ---- Pfam domains (3)
           Pfam domains (4) ----------------------------------------------Y_phosphatase-1xm2F04 F:54-152                                                                     ---- Pfam domains (4)
           Pfam domains (5) ----------------------------------------------Y_phosphatase-1xm2F05 F:54-152                                                                     ---- Pfam domains (5)
           Pfam domains (6) ----------------------------------------------Y_phosphatase-1xm2F06 F:54-152                                                                     ---- Pfam domains (6)
         Sec.struct. author ..eeee....eeeee...--..hhhhhhhhhhh.eeeeee.......hhhhhhh..eeee.........hhhhhhhhhhhhhhhhhhh...eeeee.....hhhhhhhhhhhhhh..hhhhhhhhhhh......hhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------TYR_PHOSPHATASE_2  PDB: F:82-148 UniProt: 82-148                   -------- PROSITE
           Transcript 1 (1) Exon 1.5c  PDB: F:8-35 (gapsExon 1.6  PDB: F:36-66         Exon 1.7  PDB: F:67-110 UniProt: 67-110     ------------------------Exon 1.9c [INCOMPLETE] Transcript 1 (1)
           Transcript 1 (2) ------------------------------------------------------------------------------------------------------Exon 1.8  PDB: F:110-135  --------------------- Transcript 1 (2)
                 1xm2 F   8 APVEVTYKNmRFLITHNP--ATLNKFIEELKKYGVTTIVRVCEATYDTTLVEKEGIHVLDWPFDDGAPPSNQIVDDWLSLVKIKFREEPGCCIAVHSVAGLGRAPVLVALALIEGGmKYEDAVQFIRQKRRGAFNSKQLLYLEKYRPKm 156
                                    17       | -|       37        47        57        67        77        87        97       107       117      |127       137       147        |
                                    17-MSE  25 28                                                                                             124-MSE                         156-MSE

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Alpha and beta proteins (a/b) (23833)

Fold: (Phosphotyrosine protein) phosphatases II (296)

Superfamily: (Phosphotyrosine protein) phosphatases II (296)

Family: Dual specificity phosphatase-like (27)

Protein domain: automated matches (8)

Human (Homo sapiens) [TaxId: 9606] (6)

1a	d1xm2a_	A:
1b	d1xm2c_	C:
1c	d1xm2d_	D:
1d	d1xm2e_	E:
1e	d1xm2f_	F:
1f	d1xm2b_	B:

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: Alpha-Beta Complex (3881)

Topology: Protein-Tyrosine Phosphatase; Chain A (262)

Homologous Superfamily: Protein tyrosine phosphatase superfamily (228)

Human (Homo sapiens) (196)

1a	1xm2A00	A:8-155
1b	1xm2B00	B:8-155
1c	1xm2C00	C:8-155
1d	1xm2E00	E:8-155
1e	1xm2F00	F:8-155
1f	1xm2D00	D:8-155

Asymmetric Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: Phosphatase (121)

Family: Y_phosphatase (93)

Homo sapiens (Human) (82)

1a	Y_phosphatase-1xm2F01	F:54-152
1b	Y_phosphatase-1xm2F02	F:54-152
1c	Y_phosphatase-1xm2F03	F:54-152
1d	Y_phosphatase-1xm2F04	F:54-152
1e	Y_phosphatase-1xm2F05	F:54-152
1f	Y_phosphatase-1xm2F06	F:54-152

Asymmetric Unit(hide GO term definitions)

Chain A,B,C,D,E,F (TP4A1_HUMAN | Q93096)

molecular function
	GO:0016787	hydrolase activity	Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
	GO:0016791	phosphatase activity	Catalysis of the hydrolysis of phosphoric monoesters, releasing inorganic phosphate.
	GO:0004721	phosphoprotein phosphatase activity	Catalysis of the reaction: a phosphoprotein + H2O = a protein + phosphate. Together with protein kinases, these enzymes control the state of phosphorylation of cell proteins and thereby provide an important mechanism for regulating cellular activity.
	GO:0004725	protein tyrosine phosphatase activity	Catalysis of the reaction: protein tyrosine phosphate + H2O = protein tyrosine + phosphate.
	GO:0008138	protein tyrosine/serine/threonine phosphatase activity	Catalysis of the reactions: protein serine + H2O = protein serine + phosphate; protein threonine phosphate + H2O = protein threonine + phosphate; and protein tyrosine phosphate + H2O = protein tyrosine + phosphate.
biological process
	GO:0007049	cell cycle	The progression of biochemical and morphological phases and events that occur in a cell during successive cell replication or nuclear replication events. Canonically, the cell cycle comprises the replication and segregation of genetic material followed by the division of the cell, but in endocycles or syncytial cells nuclear replication or nuclear division may not be followed by cell division.
	GO:0016311	dephosphorylation	The process of removing one or more phosphoric (ester or anhydride) residues from a molecule.
	GO:0007275	multicellular organism development	The biological process whose specific outcome is the progression of a multicellular organism over time from an initial condition (e.g. a zygote or a young adult) to a later condition (e.g. a multicellular animal or an aged adult).
	GO:0035335	peptidyl-tyrosine dephosphorylation	The removal of phosphoric residues from peptidyl-O-phospho-tyrosine to form peptidyl-tyrosine.
	GO:0030335	positive regulation of cell migration	Any process that activates or increases the frequency, rate or extent of cell migration.
	GO:0006470	protein dephosphorylation	The process of removing one or more phosphoric residues from a protein.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0009898	cytoplasmic side of plasma membrane	The leaflet the plasma membrane that faces the cytoplasm and any proteins embedded or anchored in it or attached to its surface.
	GO:0005856	cytoskeleton	Any of the various filamentous elements that form the internal framework of cells, and typically remain after treatment of the cells with mild detergent to remove membrane constituents and soluble components of the cytoplasm. The term embraces intermediate filaments, microfilaments, microtubules, the microtrabecular lattice, and other structures characterized by a polymeric filamentous nature and long-range order within the cell. The various elements of the cytoskeleton not only serve in the maintenance of cellular shape but also have roles in other cellular functions, including cellular movement, cell division, endocytosis, and movement of organelles.
	GO:0005769	early endosome	A membrane-bounded organelle that receives incoming material from primary endocytic vesicles that have been generated by clathrin-dependent and clathrin-independent endocytosis; vesicles fuse with the early endosome to deliver cargo for sorting into recycling or degradation pathways.
	GO:0005783	endoplasmic reticulum	The irregular network of unit membranes, visible only by electron microscopy, that occurs in the cytoplasm of many eukaryotic cells. The membranes form a complex meshwork of tubular channels, which are often expanded into slitlike cavities called cisternae. The ER takes two forms, rough (or granular), with ribosomes adhering to the outer surface, and smooth (with no ribosomes attached).
	GO:0005768	endosome	A vacuole to which materials ingested by endocytosis are delivered.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
	GO:0005819	spindle	The array of microtubules and associated molecules that forms between opposite poles of a eukaryotic cell during mitosis or meiosis and serves to move the duplicated chromosomes apart.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		MSE	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		SO4	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Tyr A:14 - Lys A:15	[ RasMol ]
		Tyr B:14 - Lys B:15	[ RasMol ]
		Tyr C:14 - Lys C:15	[ RasMol ]
		Tyr D:14 - Lys D:15	[ RasMol ]
		Tyr E:14 - Lys E:15	[ RasMol ]
		Tyr F:14 - Lys F:15	[ RasMol ]

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format \| Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1xm2
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	TP4A1_HUMAN \| Q93096
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	3.1.3.48
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	TP4A1_HUMAN \| Q93096
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	TP4A1_HUMAN \| Q93096	:	1rxd 5bx1

(no "Related Entries Specified in the PDB File" available for 1XM2)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (2, 24)

Sites (6, 6)

SS Bonds (0, 0)

Cis Peptide Bonds (6, 6)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (1, 6)

Exons (5, 30)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 6)

CATH Domains (1, 6)

Pfam Domains (1, 6)

Gene Ontology (22, 22)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File