Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit - manually
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit - manually
Asym./Biol. Unit - manually  (Jmol Viewer)
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  HIGH RESOLUTION CRYSTAL STRUCTURE OF PHYCOERYTHRIN 545 FROM THE MARINE CRYPTOPHYTE RHODOMONAS CS24
 
Authors :  A. B. Doust, C. N. J. Marai, S. J. Harrop, K. E. Wilk, P. M. G. Curmi, G. D. Scholes
Date :  14 Sep 04  (Deposition) - 30 Nov 04  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.10
Chains :  Asym./Biol. Unit :  A,B,C,D
Keywords :  Phycoerythrin, Light-Harvesting Protein, Cryptophyte, Photosynthesis (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  A. B. Doust, C. N. J. Marai, S. J. Harrop, K. E. Wilk, P. M. G. Curmi, G. D. Scholes
Developing A Structure-Function Model For The Cryptophyte Phycoerythrin 545 Using Ultrahigh Resolution Crystallography And Ultrafast Laser Spectroscopy
J. Mol. Biol. V. 344 135 2004
PubMed-ID: 15504407  |  Reference-DOI: 10.1016/J.JMB.2004.09.044
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - PHYCOERYTHRIN ALPHA-3 CHAIN
    Chains: A
    Organism Scientific: RHODOMONAS SP. CS24
    Organism Taxid: 79257
    Strain: CS 24
    Synonym: CRYPTOPHYTAN PHYCOERYTHRIN (ALPHA-1 CHAIN)
 
Molecule 2 - PHYCOERYTHRIN ALPHA-2 CHAIN
    Chains: B
    Organism Scientific: RHODOMONAS SP. CS24
    Organism Taxid: 79257
    Strain: CS 24
    Synonym: CRYPTOPHYTAN PHYCOERYTHRIN (ALPHA-2 CHAIN)
 
Molecule 3 - B-PHYCOERYTHRIN BETA CHAIN
    Chains: C, D
    Organism Scientific: RHODOMONAS SP. CS24
    Organism Taxid: 79257
    Strain: CS 24
    Synonym: CRYPTOPHYTAN PHYCOERYTHRIN (BETA CHAIN)

 Structural Features

(-) Chains, Units

  1234
Asymmetric/Biological Unit : ABCD

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (6, 14)

Asymmetric/Biological Unit (6, 14)
No.NameCountTypeFull Name
1CL1Ligand/IonCHLORIDE ION
2DBV2Ligand/Ion15,16-DIHYDROBILIVERDIN
3LYZ1Mod. Amino Acid5-HYDROXYLYSINE
4MEN2Mod. Amino AcidN-METHYL ASPARAGINE
5MG2Ligand/IonMAGNESIUM ION
6PEB6Ligand/IonPHYCOERYTHROBILIN

(-) Sites  (11, 11)

Asymmetric Unit (11, 11)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREILE A:68 , SER C:147 , GLN C:148 , PEB D:250 , HOH D:2234BINDING SITE FOR RESIDUE CL C 3001
02AC2SOFTWAREHOH A:2002 , HOH A:2003 , HOH B:1053 , HOH B:1054 , HOH B:1055 , HOH D:2003BINDING SITE FOR RESIDUE MG A 2001
03AC3SOFTWAREHOH D:2004 , HOH D:2005 , HOH D:2006 , HOH D:2007 , HOH D:2008 , HOH D:2009BINDING SITE FOR RESIDUE MG D 2002
04AC4SOFTWAREPHE A:14 , CYS A:19 , SER A:20 , ARG A:21 , PRO A:23 , LYS A:24 , GLU A:25 , SER A:26 , ASP A:36 , GLU A:37 , MET A:38 , MET A:39 , LYS A:41 , HOH A:2005 , HOH A:2011 , HOH A:2013 , HOH A:2038 , HOH A:2070 , HOH A:2099 , HOH A:2102 , HOH A:2103 , LEU B:62 , MET B:65 , THR B:66 , TYR C:18 , PRO D:64 , SER D:65 , ILE D:67 , SER D:68BINDING SITE FOR RESIDUE DBV A 219
05AC5SOFTWAREPHE A:64 , ASN A:76 , PHE B:14 , CYS B:19 , SER B:20 , ARG B:21 , PRO B:23 , LYS B:24 , GLU B:25 , TYR B:26 , ASP B:36 , GLU B:37 , MET B:38 , MET B:39 , LYS B:41 , HOH B:1086 , HOH B:1136 , HOH B:1138 , HOH B:1140 , HOH B:1142 , HOH B:1145 , HOH B:1151 , HOH B:1158 , HOH B:1162 , SER C:65 , ILE C:67 , SER C:68BINDING SITE FOR RESIDUE DBV B 219
06AC6SOFTWAREPHE A:64 , GLU A:65 , LYS A:66 , ASP A:69 , PRO A:71 , PHE A:72 , THR A:73 , SER A:74 , CYS C:50 , ASP C:54 , SER C:57 , GLY C:58 , CYS C:61 , ARG C:129 , ALA C:136 , CYS C:137 , PHE C:141 , ALA C:146 , SER C:147 , GLN C:148 , HOH C:3067 , HOH C:3068 , HOH C:3072 , HOH C:3073 , HOH C:3075 , HOH C:3076 , LYS D:29 , HOH D:2100BINDING SITE FOR RESIDUE PEB C 250
07AC7SOFTWAREILE A:13 , ARG A:17 , GLN A:34 , MET A:38 , LYS C:28 , ASN C:35 , LYS C:36 , LEU C:38 , ASP C:39 , SER C:40 , VAL C:142 , ASN C:143 , ASN C:144 , THR C:153 , PRO C:154 , GLN C:155 , GLY C:156 , CYS C:158 , HOH C:3053 , HOH C:3054 , HOH C:3055 , HOH C:3056 , HOH C:3057 , HOH C:3065 , HOH C:3189BINDING SITE FOR RESIDUE PEB C 258
08AC8SOFTWAREMET A:2 , LYZ A:4 , SER A:5 , ALA A:6 , MET C:59 , MEN C:72 , CYS C:73 , ARG C:77 , ARG C:78 , ALA C:81 , CYS C:82 , ARG C:84 , ASP C:85 , ILE C:88 , ARG C:108 , LEU C:120 , VAL C:122 , PRO C:123 , ASN C:127 , HOH C:3092 , HOH C:3094 , HOH C:3142 , HOH C:3144BINDING SITE FOR RESIDUE PEB C 282
09AC9SOFTWAREGLY A:67 , ILE A:68 , LYS B:64 , GLN C:148 , CL C:3001 , ASN D:47 , CYS D:50 , ASP D:54 , SER D:57 , GLY D:58 , CYS D:61 , ARG D:129 , ALA D:136 , CYS D:137 , PHE D:141 , HOH D:2072 , HOH D:2074 , HOH D:2078 , HOH D:2217 , HOH D:2227 , HOH D:2235 , HOH D:2236 , HOH D:2292 , HOH D:2314 , HOH D:2328BINDING SITE FOR RESIDUE PEB D 250
10BC1SOFTWAREILE B:13 , ASP B:15 , ARG B:17 , LYS B:34 , MET B:38 , LYS D:28 , ASN D:35 , LYS D:36 , LEU D:38 , ASP D:39 , SER D:40 , VAL D:142 , LEU D:151 , THR D:153 , PRO D:154 , GLN D:155 , GLY D:156 , CYS D:158 , HOH D:2091 , HOH D:2095 , HOH D:2096 , HOH D:2097 , HOH D:2249 , HOH D:2251 , HOH D:2252 , HOH D:2253 , HOH D:2274BINDING SITE FOR RESIDUE PEB D 258
11BC2SOFTWAREMET B:2 , LYS B:4 , SER B:5 , ALA B:6 , MEN D:72 , CYS D:73 , ARG D:77 , ARG D:78 , ALA D:81 , CYS D:82 , ARG D:84 , ASP D:85 , ILE D:88 , ARG D:108 , LEU D:120 , VAL D:122 , ASN D:127 , HOH D:2050 , HOH D:2051 , HOH D:2056 , HOH D:2059 , HOH D:2060 , HOH D:2061BINDING SITE FOR RESIDUE PEB D 282

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1XF6)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1XF6)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1XF6)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1XF6)

(-) Exons   (0, 0)

(no "Exon" information available for 1XF6)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:76
 aligned with PHE3_RHDS2 | Q00433 from UniProtKB/Swiss-Prot  Length:128

    Alignment length:76
                                    62        72        82        92       102       112       122      
           PHE3_RHDS2    53 AMDKSAKAPQITIFDHRGCSRAPKESTGGKAGGQDDEMMVKVASTKVTVSESDAAKKLQEFITFEKGIDGPFTSKN 128
               SCOP domains d1xf6a_ A: Phycoerythrin 545 alpha-subunits                                  SCOP domains
               CATH domains 1xf6A00 A:1-76 Cryptophytan Phycoerythrin (Alpha-1 Chain); Chain A           CATH domains
               Pfam domains ------Phycoerythr_ab-1xf6A01 A:7-63                            ------------- Pfam domains
         Sec.struct. author ......eeeeeeeee.................hhhh.eeeeeeeee...hhhhhhhhhhhhh.............. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------- Transcript
                 1xf6 A   1 AMDkSAKAPQITIFDHRGCSRAPKESTGGKAGGQDDEMMVKVASTKVTVSESDAAKKLQEFITFEKGIDGPFTSKN  76
                               |    10        20        30        40        50        60        70      
                               4-LYZ                                                                    


Chain B from PDB  Type:PROTEIN  Length:67
 aligned with PHE2_RHDS2 | P30943 from UniProtKB/Swiss-Prot  Length:104

    Alignment length:67
                                    47        57        67        77        87        97       
           PHE2_RHDS2    38 AMDKSAKAPVITIFDHRGCSRAPKEYTGAKAGGKDDEMMVKAQSVKIEVSTGTAEGVLATSLAKMTK 104
               SCOP domains d1xf6b_ B: Phycoerythrin 545 alpha-subunits                         SCOP domains
               CATH domains 1xf6B00 B:1-67 Cryptophytan Phycoerythrin (Alpha-1 Chain); Chain A  CATH domains
               Pfam domains ------Phycoerythr_ab-1xf6B01 B:7-63                            ---- Pfam domains
         Sec.struct. author ......eeeeeeeee.................hhhh.eeeeeeeee...hhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------- Transcript
                 1xf6 B   1 AMDKSAKAPVITIFDHRGCSRAPKEYTGAKAGGKDDEMMVKAQSVKIEVSTGTAEGVLATSLAKMTK  67
                                    10        20        30        40        50        60       


Chain C from PDB  Type:PROTEIN  Length:173
 aligned with PHEB_RHDS2 | P27198 from UniProtKB/Swiss-Prot  Length:177

    Alignment length:175
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172     
           PHEB_RHDS2     3 DAFSRVVTNADSKAAYVGGADLQALKKFISEGNKRLDSVNSIVSNASCIVSDAVSGMICENPSLISPSGNCYTNRRMAACLRDGEIILRYVSYALLSGDASVLEDRCLNGLKETYSSLGVPANSNARAVSIMKACAVAFVNNTASQKKLSTPQGDCSGLASEVGGYFDKVTAAIS 177
               SCOP domains d1xf6c_   C: Phycoerythrin beta subunit                                                                                                                                         SCOP domains
               CATH domains 1xf6C00   C:3-177 Phycocyanins                                                                                                                                                  CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhh--.....eeeehhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhh..hhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhh..............hhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1xf6 C   3 DAFSRVV--ADSKAAYVGGADLQALKKFISEGNKRLDSVNSIVSNASCIVSDAVSGMICENPSLISPSGnCYTNRRMAACLRDGEIILRYVSYALLSGDASVLEDRCLNGLKETYSSLGVPANSNARAVSIMKACAVAFVNNTASQKKLSTPQGDCSGLASEVGGYFDKVTAAIS 177
                                  | 12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172     
                                  9 12                                                          72-MEN                                                                                                     


Chain D from PDB  Type:PROTEIN  Length:177
 aligned with PHEB_RHDS2 | P27198 from UniProtKB/Swiss-Prot  Length:177

    Alignment length:177
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       
           PHEB_RHDS2     1 MLDAFSRVVTNADSKAAYVGGADLQALKKFISEGNKRLDSVNSIVSNASCIVSDAVSGMICENPSLISPSGNCYTNRRMAACLRDGEIILRYVSYALLSGDASVLEDRCLNGLKETYSSLGVPANSNARAVSIMKACAVAFVNNTASQKKLSTPQGDCSGLASEVGGYFDKVTAAIS 177
               SCOP domains d1xf6d_ D: Phycoerythrin beta subunit                                                                                                                                             SCOP domains
               CATH domains 1xf6D00 D:1-177 Phycocyanins                                                                                                                                                      CATH domains
           Pfam domains (1) -----Phycobilisome-1xf6D01 D:6-177                                                                                                                                                Pfam domains (1)
           Pfam domains (2) -----Phycobilisome-1xf6D02 D:6-177                                                                                                                                                Pfam domains (2)
         Sec.struct. author .hhhhhhhhh......eeeehhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhh..hhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhh...hhhhh......hhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1xf6 D   1 MLDAFSRVVTNADSKAAYVGGADLQALKKFISEGNKRLDSVNSIVSNASCIVSDAVSGMICENPSLISPSGnCYTNRRMAACLRDGEIILRYVSYALLSGDASVLEDRCLNGLKETYSSLGVPANSNARAVSIMKACAVAFVNNTASQKKLSTPQGDCSGLASEVGGYFDKVTAAIS 177
                                    10        20        30        40        50        60        70 |      80        90       100       110       120       130       140       150       160       170       
                                                                                                  72-MEN
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 4)

Asymmetric/Biological Unit
(-)
Class: All alpha proteins (14657)
(-)
Class: Alpha and beta proteins (a+b) (23004)

(-) CATH Domains  (2, 4)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)
(-)
Class: Mainly Alpha (13335)

(-) Pfam Domains  (2, 4)

Asymmetric/Biological Unit
(-)
Clan: Globin (291)
(-)
Clan: no clan defined [family: Phycoerythr_ab] (3)

(-) Gene Ontology  (9, 27)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (PHE3_RHDS2 | Q00433)
biological process
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
    GO:0015979    photosynthesis    The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
    GO:0018298    protein-chromophore linkage    The covalent or noncovalent attachment of a chromophore to a protein.
cellular component
    GO:0009507    chloroplast    A chlorophyll-containing plastid with thylakoids organized into grana and frets, or stroma thylakoids, and embedded in a stroma.
    GO:0009535    chloroplast thylakoid membrane    The pigmented membrane of a chloroplast thylakoid. An example of this component is found in Arabidopsis thaliana.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0030089    phycobilisome    Any of the granules, approximately 32 nm x 48 nm and consisting of highly aggregated phycobiliproteins, that are attached in arrays to the external face of a thylakoid membrane in algae of the phyla Cyanophyta and Rhodophyta, where they function as light-harvesting devices in photosynthesis. Excitation energy in the phycobilisome flows in the sequence: phycoerythrin, phycocyanin, allophycocyanin before passing to the antenna chlorophyll of photosystem II.
    GO:0009536    plastid    Any member of a family of organelles found in the cytoplasm of plants and some protists, which are membrane-bounded and contain DNA. Plant plastids develop from a common type, the proplastid.
    GO:0009579    thylakoid    A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.

Chain B   (PHE2_RHDS2 | P30943)
biological process
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
    GO:0015979    photosynthesis    The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
    GO:0018298    protein-chromophore linkage    The covalent or noncovalent attachment of a chromophore to a protein.
cellular component
    GO:0009507    chloroplast    A chlorophyll-containing plastid with thylakoids organized into grana and frets, or stroma thylakoids, and embedded in a stroma.
    GO:0009535    chloroplast thylakoid membrane    The pigmented membrane of a chloroplast thylakoid. An example of this component is found in Arabidopsis thaliana.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0030089    phycobilisome    Any of the granules, approximately 32 nm x 48 nm and consisting of highly aggregated phycobiliproteins, that are attached in arrays to the external face of a thylakoid membrane in algae of the phyla Cyanophyta and Rhodophyta, where they function as light-harvesting devices in photosynthesis. Excitation energy in the phycobilisome flows in the sequence: phycoerythrin, phycocyanin, allophycocyanin before passing to the antenna chlorophyll of photosystem II.
    GO:0009536    plastid    Any member of a family of organelles found in the cytoplasm of plants and some protists, which are membrane-bounded and contain DNA. Plant plastids develop from a common type, the proplastid.
    GO:0009579    thylakoid    A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.

Chain C,D   (PHEB_RHDS2 | P27198)
biological process
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
    GO:0015979    photosynthesis    The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
    GO:0018298    protein-chromophore linkage    The covalent or noncovalent attachment of a chromophore to a protein.
cellular component
    GO:0009507    chloroplast    A chlorophyll-containing plastid with thylakoids organized into grana and frets, or stroma thylakoids, and embedded in a stroma.
    GO:0009535    chloroplast thylakoid membrane    The pigmented membrane of a chloroplast thylakoid. An example of this component is found in Arabidopsis thaliana.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0030089    phycobilisome    Any of the granules, approximately 32 nm x 48 nm and consisting of highly aggregated phycobiliproteins, that are attached in arrays to the external face of a thylakoid membrane in algae of the phyla Cyanophyta and Rhodophyta, where they function as light-harvesting devices in photosynthesis. Excitation energy in the phycobilisome flows in the sequence: phycoerythrin, phycocyanin, allophycocyanin before passing to the antenna chlorophyll of photosystem II.
    GO:0009536    plastid    Any member of a family of organelles found in the cytoplasm of plants and some protists, which are membrane-bounded and contain DNA. Plant plastids develop from a common type, the proplastid.
    GO:0009579    thylakoid    A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    CL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    DBV  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    LYZ  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MEN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    PEB  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    BC1  [ RasMol ]  +environment [ RasMol ]
    BC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1xf6)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1xf6
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  PHE2_RHDS2 | P30943
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  PHE3_RHDS2 | Q00433
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  PHEB_RHDS2 | P27198
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  PHE2_RHDS2 | P30943
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  PHE3_RHDS2 | Q00433
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  PHEB_RHDS2 | P27198
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        PHE2_RHDS2 | P30943: 1qgw 1xg0
        PHE3_RHDS2 | Q00433: 1qgw 1xg0
        PHEB_RHDS2 | P27198: 1qgw 1xg0

(-) Related Entries Specified in the PDB File

1qgw THE SAME PROTEIN AT 1.63 ANGSTROM