Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit - manually
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit - manually
Asym./Biol. Unit - manually  (Jmol Viewer)
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF INTERNALIN C FROM LISTERIA MONOCYTOGENES
 
Authors :  A. Ooi, S. Hussain, A. Seyedarabi, R. W. Pickersgill
Date :  13 Sep 04  (Deposition) - 30 Aug 05  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.05
Chains :  Asym./Biol. Unit :  A
Keywords :  Listeria Monocytogenes; Cellular Invasion; Internalin C; Leucine-Rich Repeat; Crystal Structure, Cell Invasion (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  A. Ooi, S. Hussain, A. Seyedarabi, R. W. Pickersgill
Structure Of Internalin C From Listeria Monocytogenes.
Acta Crystallogr. , Sect. D V. 62 1287 2006
PubMed-ID: 17057330  |  Reference-DOI: 10.1107/S0907444906026746
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - INTERNALIN C
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPET-14B
    Expression System StrainBL21(DE3)PLYSS
    Expression System Taxid562
    Expression System Vector TypePLASMID
    GeneINLC
    Organism ScientificLISTERIA MONOCYTOGENES
    Organism Taxid1639

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1XEU)

(-) Sites  (0, 0)

(no "Site" information available for 1XEU)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1XEU)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1XEU)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1XEU)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1XEU)

(-) Exons   (0, 0)

(no "Exon" information available for 1XEU)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:263
 aligned with Q8Y6A8_LISMO | Q8Y6A8 from UniProtKB/TrEMBL  Length:296

    Alignment length:263
                                    43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293   
         Q8Y6A8_LISMO    34 ESIQRPTPINQVFPDPGLANAVKQNLGKQSVTDLVSQKELSGVQNFNGDNSNIQSLAGMQFFTNLKELHLSHNQISDLSPLKDLTKLEELSVNRNRLKNLNGIPSACLSRLFLDNNELRDTDSLIHLKNLEILSIRNNKLKSIVMLGFLSKLEVLDLHGNEITNTGGLTRLKKVNWIDLTGQKCVNEPVKYQPELYITNTVKDPDGRWISPYYISNGGSYVDGCVLWELPVYTDEVSYKFSEYINVGETEAIFDGTVTQPIKN 296
               SCOP domains d1xeua1 A:35-216 automated matches                                                                                                                                                    d1xeua2 A:217-297 automated matches                                               SCOP domains
               CATH domains 1xeuA01 A:35-214 Ribonuclease Inhibitor                                                                                                                                             1xeuA02 A:215-297  [code=2.60.40.1220, no name defined]                             CATH domains
           Pfam domains (1) Internalin_N-1xeuA04    -------------------------------------------------------------------------------------------------------LRR_4-1xeuA01 A:162-207                       --------------------------------LRR_adjacent-1xeuA05 A:240-297                             Pfam domains (1)
           Pfam domains (2) -------------------------------------------------------------------------------------------------------------------------------LRR_4-1xeuA02 A:162-207                       ------------------------------------------------------------------------------------------ Pfam domains (2)
           Pfam domains (3) -------------------------------------------------------------------------------------------------------------------------------LRR_4-1xeuA03 A:162-207                       ------------------------------------------------------------------------------------------ Pfam domains (3)
         Sec.struct. author ......eehhhhh.hhhhhhhhhhhhh......eehhhhhh...eee..........hhhhh....eee........hhhhh......eee..................eee........hhhhh......eee........hhhhhhh....eee...................eeeeeeeeee...ee...eeeee..............ee.hhheee..eeeee......eeeeeeeeeeee..eeeeeeeeeeeeee. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1xeu A  35 ESIQRPTPINQVFPDPGLANAVKQNLGKQSVTDLVSQKELSGVQNFNGDNSNIQSLAGMQFFTNLKELHLSHNQISDLSPLKDLTKLEELSVNRNRLKNLNGIPSACLSRLFLDNNELRDTDSLIHLKNLEILSIRNNKLKSIVMLGFLSKLEVLDLHGNEITNTGGLTRLKKVNWIDLTGQKCVNEPVKYQPELYITNTVKDPDGRWISPYYISNGGSYVDGCVLWELPVYTDEVSYKFSEYINVGETEAIFDGTVTQPIKN 297
                                    44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294   

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 2)

Asymmetric/Biological Unit

(-) CATH Domains  (2, 2)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (3, 5)

Asymmetric/Biological Unit
(-)
Clan: LRR (77)
(-)
Family: LRR_4 (28)
1aLRR_4-1xeuA01A:162-207
1bLRR_4-1xeuA02A:162-207
1cLRR_4-1xeuA03A:162-207

(-) Gene Ontology  (0, 0)

Asymmetric/Biological Unit(hide GO term definitions)
    (no "Gene Ontology" information available for 1XEU)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1xeu)
 
  Sites
(no "Sites" information available for 1xeu)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1xeu)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1xeu
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q8Y6A8_LISMO | Q8Y6A8
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  Q8Y6A8_LISMO | Q8Y6A8
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        Q8Y6A8_LISMO | Q8Y6A84cc4

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1XEU)