1X68 - JenaLib

Title :   SOLUTION STRUCTURES OF THE C-TERMINAL LIM DOMAIN OF HUMAN FHL5 PROTEIN

Authors :   N. Nameki, A. Sasagawa, M. Sato, S. Koshiba, M. Inoue, T. Kigawa, S. Yokoyama, Riken Structural Genomics/Proteomics Initiative (Rsgi)

Date :   17 May 05 (Deposition) - 17 Nov 05 (Release) - 24 Feb 09 (Revision)

Method :   SOLUTION NMR

Resolution :   NOT APPLICABLE

Chains :   NMR Structure  : A  (20x)

Keywords :   Four-And-A-Half Lim Protein 5, Zinc Finger Domain, An Actin- Interacting Protein, Structural Genomics, Nppsfa, National Project On Protein Structural And Functional Analyses, Riken Structural Genomics/Proteomics Initiative, Rsgi, Protein Binding (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   N. Nameki, A. Sasagawa, M. Sato, S. Koshiba, M. Inoue, T. Kigawa, S. Yokoyama
Solution Structures Of The C-Terminal Lim Domain Of Human Fhl5 Protein
To Be Published
PubMed: search
(for further references see the PDB file header)

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 2)

Sites (2, 2)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (1, 1)

PROSITE Motifs (2, 3)

Exons (4, 4)

NMR Structure (4, 4)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1	ENST00000326771	1	ENSE00001698333	chr6:97010460-97010596	137	FHL5_HUMAN	-	0	0	-	-
1.2	ENST00000326771	2	ENSE00001356882	chr6:97011001-97011231	231	FHL5_HUMAN	-	0	0	-	-
1.3	ENST00000326771	3	ENSE00000840214	chr6:97051478-97051648	171	FHL5_HUMAN	1-53	53	0	-	-
1.4	ENST00000326771	4	ENSE00001722415	chr6:97052626-97052800	175	FHL5_HUMAN	54-112	59	1	A:1-1	1
1.5	ENST00000326771	5	ENSE00000760835	chr6:97053778-97053947	170	FHL5_HUMAN	112-168	57	1	A:1-4 (gaps)	37
1.6b	ENST00000326771	6b	ENSE00000760836	chr6:97058448-97058634	187	FHL5_HUMAN	169-231	63	1	A:5-17 (gaps)	61
1.7	ENST00000326771	7	ENSE00001269305	chr6:97063485-97064444	960	FHL5_HUMAN	231-284	54	1	A:17-70	54

Sequences/Alignments

NMR Structure

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:76
 aligned with FHL5_HUMAN | Q5TD97 from UniProtKB/Swiss-Prot  Length:284

    Alignment length:179
                                                                                                                                                                                                      284      
                                   121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281  |      
           FHL5_HUMAN   112 GSRKMEFKGNYWHETCFVCENCRQPIGTKPLISKESGNYCVPCFEKEFAHYCNFCKKVITSGGITFCDQLWHKECFLCSGCRKDLCEEQFMSRDDYPFCVDCYNHLYANKCVACSKPISGLTGAKFICFQDSQWHSECFNCGKCSVSLVGKGFLTQNKEIFCQKCGSGMDTDI------   -
               SCOP domains --------------------------------------------------------------------------------------------------------------d1x68a1 A:8-36               d1x68a2 A:37-70                   ------ SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------LIM-1x68A01 A:8-65                                        ----------- Pfam domains
         Sec.struct. author ..---------------------------------..----------------------...------------------------------------------------...............eeee..eeee.hhh.............eeee..eeee................. Sec.struct. author
                 SAPs(SNPs) -----------------------------------------------------------------------------------------------------------------------------------R----------------------------------------------- SAPs(SNPs)
                PROSITE (1) LIM_DOMAIN_2  PDB: - UniProt: 101-160            LIM_DOMAIN_2  PDB: A:6-7 UniProt: 161-220                   --LIM_DOMAIN_2  PDB: A:9-69 UniProt: 223-283                   ------- PROSITE (1)
                PROSITE (2) LIM_DOMAIN_1  PDB: -      -------------------------LIM_DOMAIN_1  PDB: A:6-7          -------------------------LIM_DOMAIN_1  PDB: A:8-45             ------------------------------- PROSITE (2)
           Transcript 1 (1) 1--------------------------------------------------------Exon 1.6b  PDB: A:5-17 (gaps) UniProt: 169-231 [INCOMPLETE]    ----------------------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) Exon 1.5  PDB: A:1-4 (gaps) UniProt: 112-168 [INCOMPLETE]--------------------------------------------------------------Exon 1.7  PDB: A:17-70 UniProt: 231-284               ------ Transcript 1 (2)
                 1x68 A   1 GS---------------------------------SG----------------------SSG------------------------------------------------CVACSKPISGLTGAKFICFQDSQWHSECFNCGKCSVSLVGKGFLTQNKEIFCQKCGSGMDTDISGPSSG  76
                             |       -         -         -     ||  -         -         5 |       -         -         -         -         -|       17        27        37        47        57        67         
                             2                                 3|                      5 7                                                8                                                                    
                                                                4

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 2)

CATH Domains (0, 0)

Pfam Domains (1, 1)

Gene Ontology (6, 6)

NMR Structure(hide GO term definitions)

Chain A (FHL5_HUMAN | Q5TD97)

molecular function
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0003713	transcription coactivator activity	Interacting selectively and non-covalently with a activating transcription factor and also with the basal transcription machinery in order to increase the frequency, rate or extent of transcription. Cofactors generally do not bind the template nucleic acid, but rather mediate protein-protein interactions between activating transcription factors and the basal transcription machinery.
	GO:0008270	zinc ion binding	Interacting selectively and non-covalently with zinc (Zn) ions.
biological process
	GO:0045944	positive regulation of transcription from RNA polymerase II promoter	Any process that activates or increases the frequency, rate or extent of transcription from an RNA polymerase II promoter.
cellular component
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Visualization

Interactive Views

NMR Structure
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		ZN	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1x68)

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	1x68
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	FHL5_HUMAN \| Q5TD97
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Description