|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 2)
NMR Structure (1, 2)
|
Sites (2, 2)
NMR Structure (2, 2)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1X4V) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1X4V) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1X4V) |
PROSITE Motifs (1, 1)
NMR Structure (1, 1)
|
||||||||||||||||||||||||
Exons (5, 5)
NMR Structure (5, 5)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:63 aligned with ZFN2B_HUMAN | Q8WV99 from UniProtKB/Swiss-Prot Length:257 Alignment length:151 54 64 74 84 94 104 114 124 134 144 154 164 174 184 194 ZFN2B_HUMAN 45 GSAYQKDIQVPVCPLCNVPVPVARGEPPDRAVGEHIDRDCRSDPAQQKRKIFTNKCERAGCRQREMMKLTCERCSRNFCIKHRHPLDHDCSGEGHPTSRAGLAAISRAQAVASTSTVPSPSQTMPSCTSPSRATTRSPSWTAPPVIALQNG 195 SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains -------------------------------------------------------zf-AN1-1x4vA01 A:15-57 ----------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ZF_AN1 --------------------------------------------ZF_AN1 PDB: A:12-57 UniProt: 97-145 -------------------------------------------------- PROSITE Transcript 1 (1) 1.5d Exon 1.5h PDB: A:4-9 (gaps) UniProt: 51-94 Exon 1.5j PDB: A:10-57 UniProt: 95-145 ------------------------------Exon 1.5q Transcript 1 (1) Transcript 1 (2) ----------------------------------------------------------------------------------------------------Exon 1.5m PDB: A:58-61 ------------------- Transcript 1 (2) 1x4v A 1 GSS---------------------GS---------------SG-----RKIFTNKCERAGCRQREMMKLTCERCSRNFCIKHRHPLDHDCSGEGHPTS-----------------------------SGPS------------------SG 63 | - - || - - || |9 19 29 39 49 | - - - |60| - 62 3 4| 6| 8 57 58 61 62 5 7
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 1X4V) |
CATH Domains (0, 0)| (no "CATH Domain" information available for 1X4V) |
Pfam Domains (1, 1)
NMR Structure
|
Gene Ontology (5, 5)|
NMR Structure(hide GO term definitions) Chain A (ZFN2B_HUMAN | Q8WV99)
|
||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|