|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 1X4E) |
Sites (0, 0)| (no "Site" information available for 1X4E) |
SS Bonds (0, 0)| (no "SS Bond" information available for 1X4E) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1X4E) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1X4E) |
PROSITE Motifs (1, 2)
NMR Structure (1, 2)
|
||||||||||||||||||||||||
Exons (4, 4)
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:85 aligned with RBMS2_HUMAN | Q15434 from UniProtKB/Swiss-Prot Length:407 Alignment length:134 52 62 72 82 92 102 112 122 132 142 152 162 172 RBMS2_HUMAN 43 SSSGSNGNDQLSKTNLYIRGLQPGTTDQDLVKLCQPYGKIVSTKAILDKTTNKCKGYGFVDFDSPSAAQKAVTALKASGVQAQMAKQQEQDPTNLYISNLPLSMDEQELEGMLKPFGQVISTRILRDTSGTSRG 176 SCOP domains ---------------d1x4ea1 A:8-79 ----------------------------------------------- SCOP domains CATH domains -------------------------------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains ---------------RRM_1-1x4eA01 A:8-74 ---------------------------------------------------- Pfam domains
|
||||||||||||||||||||
SCOP Domains (1, 1)| NMR Structure |
CATH Domains (0, 0)| (no "CATH Domain" information available for 1X4E) |
Pfam Domains (1, 1)| NMR Structure |
Gene Ontology (5, 5)|
NMR Structure(hide GO term definitions) Chain A (RBMS2_HUMAN | Q15434)
|
||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|