1WXS - JenaLib

Title :   SOLUTION STRUCTURE OF UFM1, A UBIQUITIN-FOLD MODIFIER

Authors :   H. Sasakawa, E. Sakata, Y. Yamaguchi, M. Komatsu, K. Tatsumi, E. Kominami, K. Tanaka, K. Kato

Date :   01 Feb 05 (Deposition) - 18 Apr 06 (Release) - 24 Feb 09 (Revision)

Method :   SOLUTION NMR

Resolution :   NOT APPLICABLE

Chains :   NMR Structure  : A  (10x)

Keywords :   Ubiquitin-Fold, Structural Genomics, Unknown Function (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   H. Sasakawa, E. Sakata, Y. Yamaguchi, M. Komatsu, K. Tatsumi, E. Kominami, K. Tanaka, K. Kato
Solution Structure And Dynamics Of Ufm1, A Ubiquitin-Fold Modifier 1
Biochem. Biophys. Res. Commun. V. 343 21 2006
PubMed-ID: 16527251 | Reference-DOI: 10.1016/J.BBRC.2006.02.107
(for further references see the PDB file header)

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (6, 6)

NMR Structure (6, 6)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1d	ENST00000239878	1d	ENSE00001823289	chr13:38924018-38924058	41	UFM1_HUMAN	1-1	1	1	A:1-1	1
1.2b	ENST00000239878	2b	ENSE00001716234	chr13:38924136-38924192	57	UFM1_HUMAN	1-20	20	1	A:1-20	20
1.3a	ENST00000239878	3a	ENSE00000817162	chr13:38928376-38928433	58	UFM1_HUMAN	20-39	20	1	A:20-39	20
1.4	ENST00000239878	4	ENSE00000817163	chr13:38932230-38932269	40	UFM1_HUMAN	40-53	14	1	A:40-53	14
1.5a	ENST00000239878	5a	ENSE00000817164	chr13:38933438-38933470	33	UFM1_HUMAN	53-64	12	1	A:53-64	12
1.6c	ENST00000239878	6c	ENSE00001801205	chr13:38934848-38937140	2293	UFM1_HUMAN	64-85	22	1	A:64-83	20

Sequences/Alignments

NMR Structure

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:88
 aligned with UFM1_HUMAN | P61960 from UniProtKB/Swiss-Prot  Length:85

    Alignment length:88
                                 1                                                                                  
                                 |   5        15        25        35        45        55        65        75        
            UFM1_HUMAN    - -----MSKVSFKITLTSDPRLPYKVLSVPESTPFTAVLKFAAEEFKVPAATSAIITNDGIGINPAQTAGNVFLKHGSELRIIPRDRVG 83
               SCOP domains -----d1wxsa1 A:1-83 Ubiquitin-fold modifier 1                                            SCOP domains
               CATH domains 1wxsA00 A:-4-83 Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1       CATH domains
               Pfam domains ------Ufm1-1wxsA01 A:2-77                                                         ------ Pfam domains
         Sec.struct. author ........eeeeee..........eeee....hhhhhhhhhhhhh......eeeee..........hhhhhhhhh..eeeeee..... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) -----1------------------Exon 1.3a           Exon 1.4      ----------Exon 1.6c            Transcript 1 (1)
           Transcript 1 (2) -----Exon 1.2b           --------------------------------Exon 1.5a   ------------------- Transcript 1 (2)
                  1wxs A -4 GPLGSMSKVSFKITLTSDPRLPYKVLSVPESTPFTAVLKFAAEEFKVPAATSAIITNDGIGINPAQTAGNVFLKHGSELRIIPRDRVG 83
                                     5        15        25        35        45        55        65        75

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 1)

CATH Domains (1, 1)

Pfam Domains (1, 1)

Gene Ontology (7, 7)

NMR Structure(hide GO term definitions)

Chain A (UFM1_HUMAN | P61960)

biological process
	GO:1990592	protein K69-linked ufmylation	A protein ufmylation process in which a polymer of the ubiquitin-like protein UFM1 is formed by linkages between lysine residues at position 69 of the UFM1 monomers, is added to a protein.
	GO:0071569	protein ufmylation	Covalent attachment of the ubiquitin-like protein UFM1 to another protein.
	GO:0033146	regulation of intracellular estrogen receptor signaling pathway	Any process that modulates the frequency, rate or extent of the activity of an intracellular estrogen receptor signaling pathway.
	GO:0034976	response to endoplasmic reticulum stress	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stress acting at the endoplasmic reticulum. ER stress usually results from the accumulation of unfolded or misfolded proteins in the ER lumen.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Visualization

Interactive Views

NMR Structure
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1wxs)

	Sites
(no "Sites" information available for 1wxs)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1wxs)

Still Images

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ NMR Structure - model 1 PNG format \| NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	1wxs
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	UFM1_HUMAN \| P61960
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Analysis Tools

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	UFM1_HUMAN \| P61960
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

Description