Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  SOLUTION STRUCTURE OF BUTX-MTX: A BUTANTOXIN-MAUROTOXIN CHIMERA
 
Authors :  S. M'Barek, B. Chagot, N. Andreotti, V. Visan, P. Mansuelle, S. Grissmer, M. Marrakchi, M. El Ayeb, F. Sampieri, H. Darbon, Z. Fajloun, M. De Waard, J. -M. Sabatier
Date :  16 Nov 04  (Deposition) - 30 Nov 04  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (25x)
Keywords :  Maurotoxin, Butantoxin, Scorpion Toxin, K+ Channels, Molecular Contacts, Toxin Affinity (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  S. M'Barek, B. Chagot, N. Andreotti, V. Visan, P. Mansuelle, S. Grissmer, M. Marrakchi, M. El Ayeb, F. Sampieri, H. Darbon, Z. Fajloun, M. De Waard, J. M. Sabatier
Increasing The Molecular Contacts Between Maurotoxin And Kv1. 2 Channel Augments Ligand Affinity.
Proteins V. 60 401 2005
PubMed-ID: 15971207  |  Reference-DOI: 10.1002/PROT.20509
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - BUTX-MTX
    Chains: A
    Engineered: YES
    Other Details: BUTANTOXIN-MAUROTOXIN CHIMERA (BUTANTOXIN: TOXIN FROM THE BRAZILIAN SCORPION TITYUS SERRULATUS, MAUROTOXIN: TOXIN FROM THE SCORPION S. MAURUS PALMATUS)
    Synonym: BUTANTOXIN-MAUROTOXIN
    Synthetic: YES

 Structural Features

(-) Chains, Units

  
NMR Structure (25x): 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1WT7)

(-) Sites  (0, 0)

(no "Site" information available for 1WT7)

(-) SS Bonds  (5, 5)

NMR Structure
No.Residues
1A:2 -A:5
2A:10 -A:31
3A:16 -A:36
4A:20 -A:38
5A:26 -A:41

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1WT7)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1WT7)

(-) PROSITE Motifs  (1, 1)

NMR Structure (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1SCORP_SHORT_TOXINPS01138 Scorpion short toxins signature.KAX62_SCOPA9-31  1A:16-38

(-) Exons   (0, 0)

(no "Exon" information available for 1WT7)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:41
 aligned with KAX62_SCOPA | P80719 from UniProtKB/Swiss-Prot  Length:34

    Alignment length:41
                                   1                                 
                                   | 3        13        23        33 
           KAX62_SCOPA    - -------VSCTGSKDCYAPCRKQTGCPNAKCINKSCKCYGC 34
               SCOP domains d1wt7a_ A: Maurotoxin                     SCOP domains
               CATH domains 1wt7A00 A:1-41                            CATH domains
               Pfam domains ----------------------------------------- Pfam domains
         Sec.struct. author ...........hhhhhhhhhhhhhh...eeee..eeee... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------- SAPs(SNPs)
                    PROSITE ---------------SCORP_SHORT_TOXIN      --- PROSITE
                 Transcript ----------------------------------------- Transcript
                  1wt7 A  1 WCSTCLDLACTGSKDCYAPCRKQTGCPNAKCINKSCKCYGC 41
                                    10        20        30        40
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure
(-)
Class: Small proteins (3458)

(-) CATH Domains  (1, 1)

NMR Structure
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1WT7)

(-) Gene Ontology  (4, 8)

NMR Structure(hide GO term definitions)
Chain A   (KAX62_SCOPA | P80719)
molecular function
    GO:0008200    ion channel inhibitor activity    Stops, prevents, or reduces the activity of an ion channel.
biological process
    GO:0006952    defense response    Reactions, triggered in response to the presence of a foreign body or the occurrence of an injury, which result in restriction of damage to the organism attacked or prevention/recovery from the infection caused by the attack.
    GO:0009405    pathogenesis    The set of specific processes that generate the ability of an organism to induce an abnormal, generally detrimental state in another organism.
cellular component
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1wt7)
 
  Sites
(no "Sites" information available for 1wt7)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1wt7)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ NMR Structure - model 1 PNG format | NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1wt7
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  KA121_TITSE | P59936
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  KAX62_SCOPA | P80719
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  KA121_TITSE | P59936
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  KAX62_SCOPA | P80719
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        KA121_TITSE | P59936: 1c55 1c56
        KAX62_SCOPA | P80719: 1txm 1wpd

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1WT7)