Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  EVIDENCE FOR DOMAIN-SPECIFIC RECOGNITION OF SK AND KV CHANNELS BY MTX AND HSTX1 SCORPION TOXINS
 
Authors :  I. Regaya, C. Beeton, G. Ferrat, N. Andreotti, G. K. Chandy, H. Darbon, M. De Waard, J. M. Sabatier
Date :  01 Sep 04  (Deposition) - 19 Oct 04  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (20x)
Keywords :  Neurotoxin, Chimera (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  I. Regaya, C. Beeton, G. Ferrat, N. Andreotti, H. Darbon, M. De Waard, J. M. Sabatier
Evidence For Domain-Specific Recognition Of Sk And Kv Channels By Mtx And Hstx1 Scorpion Toxins
J. Biol. Chem. V. 279 55690 2004
PubMed-ID: 15498765  |  Reference-DOI: 10.1074/JBC.M410055200
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - MTX-HSTX1
    ChainsA
    Organism Common, ASIAN FOREST SCORPION
    Organism ScientificSCORPIO MAURUS PALMATUS, HETEROMETRUS SPINIFER
    Organism Taxid53957,118530
    StrainPALMATUS,

 Structural Features

(-) Chains, Units

  
NMR Structure (20x)

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1WPD)

(-) Sites  (0, 0)

(no "Site" information available for 1WPD)

(-) SS Bonds  (4, 4)

NMR Structure
No.Residues
1A:3 -A:24
2A:9 -A:29
3A:13 -A:31
4A:19 -A:34

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1WPD)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1WPD)

(-) PROSITE Motifs  (1, 1)

NMR Structure (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1SCORP_SHORT_TOXINPS01138 Scorpion short toxins signature.KAX62_SCOPA9-31  1A:9-31
KAX63_HETSP9-31  1A:9-31

(-) Exons   (0, 0)

(no "Exon" information available for 1WPD)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:34
 aligned with KAX62_SCOPA | P80719 from UniProtKB/Swiss-Prot  Length:34

    Alignment length:34
                                    10        20        30    
           KAX62_SCOPA    1 VSCTGSKDCYAPCRKQTGCPNAKCINKSCKCYGC 34
               SCOP domains d1wpda_ A: Maurotoxin              SCOP domains
               CATH domains ---------------------------------- CATH domains
               Pfam domains ---------------------------------- Pfam domains
         Sec.struct. author ........hhhhhhhhhh................ Sec.struct. author
                 SAPs(SNPs) ---------------------------------- SAPs(SNPs)
                PROSITE (2) --------SCORP_SHORT_TOXIN      --- PROSITE (2)
                 Transcript ---------------------------------- Transcript
                  1wpd A  1 VSCTGSKDCYAPCRKQTGCPYGKCMNRKCKCNRC 34
                                    10        20        30    

Chain A from PDB  Type:PROTEIN  Length:34
 aligned with KAX63_HETSP | P59867 from UniProtKB/Swiss-Prot  Length:34

    Alignment length:34
                                    10        20        30    
           KAX63_HETSP    1 ASCRTPKDCADPCRKETGCPYGKCMNRKCKCNRC 34
               SCOP domains d1wpda_ A: Maurotoxin              SCOP domains
               CATH domains ---------------------------------- CATH domains
               Pfam domains ---------------------------------- Pfam domains
         Sec.struct. author ........hhhhhhhhhh................ Sec.struct. author
                 SAPs(SNPs) ---------------------------------- SAPs(SNPs)
                    PROSITE --------SCORP_SHORT_TOXIN      --- PROSITE
                 Transcript ---------------------------------- Transcript
                  1wpd A  1 VSCTGSKDCYAPCRKQTGCPYGKCMNRKCKCNRC 34
                                    10        20        30    

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 1WPD)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1WPD)

(-) Gene Ontology  (4, 8)

NMR Structure(hide GO term definitions)
Chain A   (KAX63_HETSP | P59867)
molecular function
    GO:0008200    ion channel inhibitor activity    Stops, prevents, or reduces the activity of an ion channel.
biological process
    GO:0006952    defense response    Reactions, triggered in response to the presence of a foreign body or the occurrence of an injury, which result in restriction of damage to the organism attacked or prevention/recovery from the infection caused by the attack.
    GO:0009405    pathogenesis    The set of specific processes that generate the ability of an organism to induce an abnormal, generally detrimental state in another organism.
cellular component
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.

Chain A   (KAX62_SCOPA | P80719)
molecular function
    GO:0008200    ion channel inhibitor activity    Stops, prevents, or reduces the activity of an ion channel.
biological process
    GO:0006952    defense response    Reactions, triggered in response to the presence of a foreign body or the occurrence of an injury, which result in restriction of damage to the organism attacked or prevention/recovery from the infection caused by the attack.
    GO:0009405    pathogenesis    The set of specific processes that generate the ability of an organism to induce an abnormal, generally detrimental state in another organism.
cellular component
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1wpd)
 
  Sites
(no "Sites" information available for 1wpd)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1wpd)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1wpd
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  KAX62_SCOPA | P80719
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  KAX63_HETSP | P59867
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  KAX62_SCOPA | P80719
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  KAX63_HETSP | P59867
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        KAX62_SCOPA | P807191txm 1wt7
        KAX63_HETSP | P598671quz 1y2p

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1WPD)