1WLZ - JenaLib

Asymmetric Unit (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Biological Unit 3 (Jmol Viewer)

Biological Unit 4 (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF DJBP FRAGMENT WHICH WAS OBTAINED BY LIMITED PROTEOLYSIS

Authors :   K. Honbou, N. Suzuki, M. Horiuchi, T. Taira, T. Niki, H. Ariga, F. Inagaki

Date :   01 Jul 04 (Deposition) - 23 Aug 05 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.60

Chains :   Asym. Unit : A,B,C,D
Biol. Unit 1: A  (1x)
Biol. Unit 2: B  (1x)
Biol. Unit 3: C  (1x)
Biol. Unit 4: D  (1x)

Keywords :   Ef-Hand Like, Unknown Function (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   K. Honbou, N. Suzuki, M. Horiuchi, T. Taira, T. Niki, H. Ariga, F. Inagaki
Crystal Structure Of Djbp Fragment Which Was Obtained By Limited Proteolysis
To Be Published
PubMed: search
(for further references see the PDB file header)

Molecule 1 - CAP-BINDING PROTEIN COMPLEX INTERACTING PROTEIN 1 ISOFORM A
	Chains	:	A, B, C, D
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI BL21(DE3)
	Expression System Plasmid	:	PGEX-6P-1
	Expression System Strain	:	BL21(DE3)
	Expression System Taxid	:	469008
	Expression System Vector Type	:	PLASMID
	Fragment	:	RESIDUES 229-329
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	DJBP

		1	2	3	4
Asymmetric Unit	:	A	B	C	D
Biological Unit 1 (1x)	:	A
Biological Unit 2 (1x)	:		B
Biological Unit 3 (1x)	:			C
Biological Unit 4 (1x)	:				D

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 1WLZ)

(no "Site" information available for 1WLZ)

(no "SS Bond" information available for 1WLZ)

(no "Cis Peptide Bond" information available for 1WLZ)

(no "SAP(SNP)/Variant" information available for 1WLZ)

Asymmetric Unit (1, 8)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	EF_HAND_2	PS50222	EF-hand calcium-binding domain profile.	EFCB6_HUMAN	70-105 172-207 297-332 403-438 439-474 504-539 634-669 741-776 847-882 883-918 964-999 1069-1104 1176-1211 1212-1247 1359-1394 1439-1469 1470-1501	8	- - - - - - - - - - - - A:245-280 B:245-280 C:245-280 D:245-280 A:281-311 B:281-310 C:281-311 D:281-311 - - -

Biological Unit 1 (1, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	EF_HAND_2	PS50222	EF-hand calcium-binding domain profile.	EFCB6_HUMAN	70-105 172-207 297-332 403-438 439-474 504-539 634-669 741-776 847-882 883-918 964-999 1069-1104 1176-1211 1212-1247 1359-1394 1439-1469 1470-1501	2	- - - - - - - - - - - - A:245-280 - - - A:281-311 - - - - - -

Biological Unit 2 (1, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	EF_HAND_2	PS50222	EF-hand calcium-binding domain profile.	EFCB6_HUMAN	70-105 172-207 297-332 403-438 439-474 504-539 634-669 741-776 847-882 883-918 964-999 1069-1104 1176-1211 1212-1247 1359-1394 1439-1469 1470-1501	2	- - - - - - - - - - - - - B:245-280 - - - B:281-310 - - - - -

Biological Unit 3 (1, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	EF_HAND_2	PS50222	EF-hand calcium-binding domain profile.	EFCB6_HUMAN	70-105 172-207 297-332 403-438 439-474 504-539 634-669 741-776 847-882 883-918 964-999 1069-1104 1176-1211 1212-1247 1359-1394 1439-1469 1470-1501	2	- - - - - - - - - - - - - - C:245-280 - - - C:281-311 - - - -

Biological Unit 4 (1, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	EF_HAND_2	PS50222	EF-hand calcium-binding domain profile.	EFCB6_HUMAN	70-105 172-207 297-332 403-438 439-474 504-539 634-669 741-776 847-882 883-918 964-999 1069-1104 1176-1211 1212-1247 1359-1394 1439-1469 1470-1501	2	- - - - - - - - - - - - - - - D:245-280 - - - D:281-311 - - -

Asymmetric Unit (2, 8)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1c	ENST00000262726	1c	ENSE00001561226	chr22:44208157-44208048	110	EFCB6_HUMAN	-	0	0	-	-
1.2	ENST00000262726	2	ENSE00001408769	chr22:44205011-44204875	137	EFCB6_HUMAN	-	0	0	-	-
1.4b	ENST00000262726	4b	ENSE00002181221	chr22:44178205-44178060	146	EFCB6_HUMAN	1-47	47	0	-	-
1.5	ENST00000262726	5	ENSE00001680857	chr22:44168983-44168772	212	EFCB6_HUMAN	47-117	71	0	-	-
1.6	ENST00000262726	6	ENSE00001713590	chr22:44161273-44161185	89	EFCB6_HUMAN	118-147	30	0	-	-
1.7	ENST00000262726	7	ENSE00001596147	chr22:44151712-44151646	67	EFCB6_HUMAN	147-169	23	0	-	-
1.8	ENST00000262726	8	ENSE00000656907	chr22:44131873-44131737	137	EFCB6_HUMAN	170-215	46	0	-	-
1.9	ENST00000262726	9	ENSE00000656906	chr22:44127691-44127579	113	EFCB6_HUMAN	215-253	39	0	-	-
1.10a	ENST00000262726	10a	ENSE00001150120	chr22:44112852-44112728	125	EFCB6_HUMAN	253-294	42	0	-	-
1.11	ENST00000262726	11	ENSE00001313550	chr22:44107503-44107355	149	EFCB6_HUMAN	295-344	50	0	-	-
1.12	ENST00000262726	12	ENSE00001297455	chr22:44083461-44083351	111	EFCB6_HUMAN	344-381	38	0	-	-
1.13a	ENST00000262726	13a	ENSE00001318450	chr22:44079735-44079627	109	EFCB6_HUMAN	381-417	37	0	-	-
1.14	ENST00000262726	14	ENSE00001297735	chr22:44074043-44073876	168	EFCB6_HUMAN	418-473	56	0	-	-
1.15a	ENST00000262726	15a	ENSE00001328068	chr22:44068185-44068126	60	EFCB6_HUMAN	474-493	20	0	-	-
1.16	ENST00000262726	16	ENSE00001045631	chr22:44068013-44067853	161	EFCB6_HUMAN	494-547	54	0	-	-
1.17	ENST00000262726	17	ENSE00001186138	chr22:44064925-44064752	174	EFCB6_HUMAN	547-605	59	0	-	-
1.18	ENST00000262726	18	ENSE00001045647	chr22:44063152-44062984	169	EFCB6_HUMAN	605-661	57	0	-	-
1.19	ENST00000262726	19	ENSE00001045654	chr22:44031096-44030982	115	EFCB6_HUMAN	662-700	39	0	-	-
1.20	ENST00000262726	20	ENSE00001045633	chr22:44028118-44027985	134	EFCB6_HUMAN	700-744	45	0	-	-
1.21	ENST00000262726	21	ENSE00001045652	chr22:44022559-44022327	233	EFCB6_HUMAN	745-822	78	0	-	-
1.22	ENST00000262726	22	ENSE00000880629	chr22:44011802-44011706	97	EFCB6_HUMAN	822-854	33	0	-	-
1.23	ENST00000262726	23	ENSE00001275750	chr22:44004480-44004362	119	EFCB6_HUMAN	855-894	40	0	-	-
1.24	ENST00000262726	24	ENSE00001186196	chr22:43996143-43995949	195	EFCB6_HUMAN	894-959	66	0	-	-
1.25	ENST00000262726	25	ENSE00000880627	chr22:43986109-43985954	156	EFCB6_HUMAN	959-1011	53	0	-	-
1.26	ENST00000262726	26	ENSE00000880626	chr22:43976539-43976344	196	EFCB6_HUMAN	1011-1076	66	0	-	-
1.27	ENST00000262726	27	ENSE00000880625	chr22:43972368-43972177	192	EFCB6_HUMAN	1077-1140	64	0	-	-
1.29a	ENST00000262726	29a	ENSE00001345507	chr22:43950976-43950749	228	EFCB6_HUMAN	1141-1216	76	4	A:227-285 B:227-285 C:229-285 D:229-285	59 59 57 57
1.30	ENST00000262726	30	ENSE00000656896	chr22:43936237-43936007	231	EFCB6_HUMAN	1217-1293	77	4	A:286-311 B:286-310 C:286-311 D:286-311	26 25 26 26
1.31	ENST00000262726	31	ENSE00001275683	chr22:43933425-43933257	169	EFCB6_HUMAN	1294-1350	57	0	-	-
1.32	ENST00000262726	32	ENSE00000656894	chr22:43930752-43930568	185	EFCB6_HUMAN	1350-1411	62	0	-	-
1.35	ENST00000262726	35	ENSE00001150176	chr22:43926844-43926695	150	EFCB6_HUMAN	1412-1461	50	0	-	-
1.36d	ENST00000262726	36d	ENSE00001920361	chr22:43924855-43924624	232	EFCB6_HUMAN	1462-1501	40	0	-	-

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:85
 aligned with EFCB6_HUMAN | Q5THR3 from UniProtKB/Swiss-Prot  Length:1501

    Alignment length:85
                                  1167      1177      1187      1197      1207      1217      1227      1237     
         EFCB6_HUMAN   1158 PKATADRDILARLHKAVTSHYHAITQEFENFDTMKTNTISREEFRAICNRRVQILTDEQFDRLWNEMPVNAKGRLKYPDFLSRFS 1242
               SCOP domains --d1wlza1 A:229-311 DJ-1-binding protein, DJBP                                        SCOP domains
               CATH domains ------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....hhhhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhh...hhhhhhhhhh..........hhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------EF_HAND_2  PDB: A:245-280           EF_HAND_2  PDB: A:281-311       PROSITE
               Transcript 1 Exon 1.29a  PDB: A:227-285 UniProt: 1141-1216 [INCOMPLETE] Exon 1.30  PDB: A:286-311  Transcript 1
                1wlz A  227 HMATADRDILARLHKAVTSHYHAITQEFENFDTMKTNTISREEFRAICNRRVQILTDEQFDRLWNEMPVNAKGRLKYPDFLSRFS  311
                                   236       246       256       266       276       286       296       306

Chain B from PDB  Type:PROTEIN  Length:84
 aligned with EFCB6_HUMAN | Q5THR3 from UniProtKB/Swiss-Prot  Length:1501

    Alignment length:84
                                  1167      1177      1187      1197      1207      1217      1227      1237    
         EFCB6_HUMAN   1158 PKATADRDILARLHKAVTSHYHAITQEFENFDTMKTNTISREEFRAICNRRVQILTDEQFDRLWNEMPVNAKGRLKYPDFLSRF 1241
               SCOP domains d1wlzb_ B: automated matches                                                         SCOP domains
               CATH domains ------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .....hhhhhhhhhhhhhhhhhhhhhhhhhhh.....eehhhhhhhhhhhhh...hhhhhhhhhh.........eehhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------EF_HAND_2  PDB: B:245-280           EF_HAND_2  PDB: B:281-310      PROSITE
               Transcript 1 Exon 1.29a  PDB: B:227-285 UniProt: 1141-1216 [INCOMPLETE] Exon 1.30  PDB: B:286-310 Transcript 1
                1wlz B  227 HMATADRDILARLHKAVTSHYHAITQEFENFDTMKTNTISREEFRAICNRRVQILTDEQFDRLWNEMPVNAKGRLKYPDFLSRF  310
                                   236       246       256       266       276       286       296       306

Chain C from PDB  Type:PROTEIN  Length:83
 aligned with EFCB6_HUMAN | Q5THR3 from UniProtKB/Swiss-Prot  Length:1501

    Alignment length:83
                                  1169      1179      1189      1199      1209      1219      1229      1239   
         EFCB6_HUMAN   1160 ATADRDILARLHKAVTSHYHAITQEFENFDTMKTNTISREEFRAICNRRVQILTDEQFDRLWNEMPVNAKGRLKYPDFLSRFS 1242
               SCOP domains d1wlzc_ C: automated matches                                                        SCOP domains
               CATH domains ----------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhhhhhhhhhhhhhh.....eehhhhhhhhhhhhh...hhhhhhhhhhh........eehhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------EF_HAND_2  PDB: C:245-280           EF_HAND_2  PDB: C:281-311       PROSITE
               Transcript 1 Exon 1.29a  PDB: C:229-285 UniProt: 1141-1216            Exon 1.30  PDB: C:286-311  Transcript 1
                1wlz C  229 ATADRDILARLHKAVTSHYHAITQEFENFDTMKTNTISREEFRAICNRRVQILTDEQFDRLWNEMPVNAKGRLKYPDFLSRFS  311
                                   238       248       258       268       278       288       298       308

Chain D from PDB  Type:PROTEIN  Length:83
 aligned with EFCB6_HUMAN | Q5THR3 from UniProtKB/Swiss-Prot  Length:1501

    Alignment length:83
                                  1169      1179      1189      1199      1209      1219      1229      1239   
         EFCB6_HUMAN   1160 ATADRDILARLHKAVTSHYHAITQEFENFDTMKTNTISREEFRAICNRRVQILTDEQFDRLWNEMPVNAKGRLKYPDFLSRFS 1242
               SCOP domains d1wlzd_ D: automated matches                                                        SCOP domains
               CATH domains ----------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) -----EF_hand_6-1wlzD01 D:234-277                 DUF1880-1wlzD05 D:278-311          Pfam domains (1)
           Pfam domains (2) -----EF_hand_6-1wlzD02 D:234-277                 DUF1880-1wlzD06 D:278-311          Pfam domains (2)
           Pfam domains (3) -----EF_hand_6-1wlzD03 D:234-277                 DUF1880-1wlzD07 D:278-311          Pfam domains (3)
           Pfam domains (4) -----EF_hand_6-1wlzD04 D:234-277                 DUF1880-1wlzD08 D:278-311          Pfam domains (4)
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....eehhhhhhhhhhhhh...hhhhhhhhhh.........eehhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------EF_HAND_2  PDB: D:245-280           EF_HAND_2  PDB: D:281-311       PROSITE
               Transcript 1 Exon 1.29a  PDB: D:229-285 UniProt: 1141-1216            Exon 1.30  PDB: D:286-311  Transcript 1
                1wlz D  229 ATADRDILARLHKAVTSHYHAITQEFENFDTMKTNTISREEFRAICNRRVQILTDEQFDRLWNEMPVNAKGRLKYPDFLSRFS  311
                                   238       248       258       268       278       288       298       308

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: All alpha proteins (14657)

Fold: EF Hand-like (739)

Superfamily: EF-hand (657)

Family: EF-hand modules in multidomain proteins (29)

Protein domain: automated matches (1)

Human (Homo sapiens) [TaxId: 9606] (1)

1a	d1wlzb_	B:
1b	d1wlzc_	C:
1c	d1wlzd_	D:

Protein domain: DJ-1-binding protein, DJBP (1)

Human (Homo sapiens) [TaxId: 9606] (1)

d1wlza1

A:229-311

(no "CATH Domain" information available for 1WLZ)

Asymmetric Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: EF_hand (270)

Family: EF_hand_6 (75)

Homo sapiens (Human) (34)

1a	EF_hand_6-1wlzD01	D:234-277
1b	EF_hand_6-1wlzD02	D:234-277
1c	EF_hand_6-1wlzD03	D:234-277
1d	EF_hand_6-1wlzD04	D:234-277

Clan: no clan defined [family: DUF1880] (1)

Family: DUF1880 (1)

Homo sapiens (Human) (1)

2a	DUF1880-1wlzD05	D:278-311
2b	DUF1880-1wlzD06	D:278-311
2c	DUF1880-1wlzD07	D:278-311
2d	DUF1880-1wlzD08	D:278-311

Asymmetric Unit(hide GO term definitions)

Chain A,B,C,D (EFCB6_HUMAN | Q5THR3)

molecular function
	GO:0005509	calcium ion binding	Interacting selectively and non-covalently with calcium ions (Ca2+).
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
biological process
	GO:0006355	regulation of transcription, DNA-templated	Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
	GO:0006351	transcription, DNA-templated	The cellular synthesis of RNA on a template of DNA.
cellular component
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1wlz)

	Sites
(no "Sites" information available for 1wlz)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1wlz)

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]
		Biological Unit 3	[ Jena3D ]
		Biological Unit 4	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 2 PNG format \| Biol. Unit 3 PNG format \| Biol. Unit 4 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1wlz
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	EFCB6_HUMAN \| Q5THR3
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	EFCB6_HUMAN \| Q5THR3
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	EFCB6_HUMAN \| Q5THR3	:	5d67

(no "Related Entries Specified in the PDB File" available for 1WLZ)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (1, 8)

Exons (2, 8)

Sequences/Alignments

Classification and Annotation

SCOP Domains (2, 4)

CATH Domains (0, 0)

Pfam Domains (2, 8)

Gene Ontology (5, 5)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File