Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym.Unit - manually
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asym.Unit - manually
Asym.Unit - manually  (Jmol Viewer)
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  L122E MUTANT OF FMN-BINDING PROTEIN FROM DESULFOVIBRIO VULGARIS (MIYAZAKI F)
 
Authors :  N. Shibata, Y. Higuchi
Date :  28 Jun 04  (Deposition) - 19 Jul 05  (Release) - 28 Apr 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.90
Chains :  Asym. Unit :  A,B,C,D
Biol. Unit 1:  A,B  (1x)
Biol. Unit 2:  C,D  (1x)
Keywords :  Electron Transport, Flavoprotein, Fmn (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  M. Kitamura, K. Terakawa, H. Inoue, T. Hayashida, K. Suto, Y. Morimoto, N. Yasuoka, N. Shibata, Y. Higuchi
Determination Of The Role Of The Carboxyl-Terminal Leucine-122 In Fmn-Binding Protein By Mutational And Structural Analysis.
J. Biochem. V. 141 459 2007
PubMed-ID: 17261542  |  Reference-DOI: 10.1093/JB/MVM051
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - FMN-BINDING PROTEIN
    Chains: A, B, C, D
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Mutation: YES
    Organism Scientific: DESULFOVIBRIO VULGARIS STR. 'MIYAZAKI F'
    Organism Taxid: 883
    Strain: MIYAZAKI F

 Structural Features

(-) Chains, Units

  1234
Asymmetric Unit : ABCD
Biological Unit 1 (1x): AB  
Biological Unit 2 (1x):   CD

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 4)

Asymmetric Unit (1, 4)
No.NameCountTypeFull Name
1FMN4Ligand/IonFLAVIN MONONUCLEOTIDE
Biological Unit 1 (1, 2)
No.NameCountTypeFull Name
1FMN2Ligand/IonFLAVIN MONONUCLEOTIDE
Biological Unit 2 (1, 2)
No.NameCountTypeFull Name
1FMN2Ligand/IonFLAVIN MONONUCLEOTIDE

(-) Sites  (4, 4)

Asymmetric Unit (4, 4)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREHIS A:27 , VAL A:29 , ASN A:30 , THR A:31 , TRP A:32 , TYR A:35 , PRO A:47 , VAL A:48 , GLY A:49 , GLY A:50 , MET A:51 , HIS A:52 , LYS A:53 , THR A:54 , HOH A:1139 , HOH A:1140 , HOH A:1152 , GLY B:82 , THR B:121 , GLU B:122 , HOH B:2160BINDING SITE FOR RESIDUE FMN A 1123
2AC2SOFTWAREGLY A:82 , THR A:121 , GLU A:122 , HIS B:27 , VAL B:29 , ASN B:30 , THR B:31 , TRP B:32 , TYR B:35 , PRO B:47 , VAL B:48 , GLY B:49 , GLY B:50 , MET B:51 , HIS B:52 , LYS B:53 , THR B:54 , TRP B:106 , HOH B:2136 , HOH B:2158 , HOH B:2159BINDING SITE FOR RESIDUE FMN B 2123
3AC3SOFTWAREVAL C:15 , HIS C:27 , VAL C:29 , ASN C:30 , THR C:31 , TRP C:32 , TYR C:35 , PRO C:47 , GLY C:49 , GLY C:50 , MET C:51 , HIS C:52 , LYS C:53 , THR C:54 , TRP C:106 , HOH C:3131 , HOH C:3156 , GLY D:82 , THR D:121 , GLU D:122 , HOH D:4201BINDING SITE FOR RESIDUE FMN C 3123
4AC4SOFTWAREGLY C:82 , THR C:121 , GLU C:122 , HOH C:3138 , HOH C:3159 , HIS D:27 , VAL D:29 , ASN D:30 , THR D:31 , TRP D:32 , TYR D:35 , PRO D:47 , VAL D:48 , GLY D:49 , GLY D:50 , MET D:51 , HIS D:52 , LYS D:53 , THR D:54 , TRP D:106 , HOH D:4151 , HOH D:4157 , HOH D:4228 , HOH D:4230BINDING SITE FOR RESIDUE FMN D 4123

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1WLK)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1WLK)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1WLK)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1WLK)

(-) Exons   (0, 0)

(no "Exon" information available for 1WLK)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:122
 aligned with FMNB_DESVM | Q46604 from UniProtKB/Swiss-Prot  Length:122

    Alignment length:122
                                    10        20        30        40        50        60        70        80        90       100       110       120  
           FMNB_DESVM     1 MLPGTFFEVLKNEGVVAIATQGEDGPHLVNTWNSYLKVLDGNRIVVPVGGMHKTEANVARDERVLMTLGSRKVAGRNGPGTGFLIRGSAAFRTDGPEFEAIARFKWARAALVITVVSAEQTL 122
               SCOP domains d1wlka_ A: FMN-binding protein                                                                                             SCOP domains
               CATH domains 1wlkA00 A:1-122 Electron Transport, Fmn-binding Protein; Chain A                                                           CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhh....eeeeeee....eeeeeee.hhheee...eeeeee..hhhhhhhhhhh.eeeeeeeeeeee....eeeeeeeeeeeeee..hhhhhh........eeeeeeeeeeeeee Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------- Transcript
                 1wlk A   1 MLPGTFFEVLKNEGVVAIATQGEDGPHLVNTWNSYLKVLDGNRIVVPVGGMHKTEANVARDERVLMTLGSRKVAGRNGPGTGFLIRGSAAFRTDGPEFEAIARFKWARAALVITVVSAEQTE 122
                                    10        20        30        40        50        60        70        80        90       100       110       120  


Chain B from PDB  Type:PROTEIN  Length:122
 aligned with FMNB_DESVM | Q46604 from UniProtKB/Swiss-Prot  Length:122

    Alignment length:122
                                    10        20        30        40        50        60        70        80        90       100       110       120  
           FMNB_DESVM     1 MLPGTFFEVLKNEGVVAIATQGEDGPHLVNTWNSYLKVLDGNRIVVPVGGMHKTEANVARDERVLMTLGSRKVAGRNGPGTGFLIRGSAAFRTDGPEFEAIARFKWARAALVITVVSAEQTL 122
               SCOP domains d1wlkb_ B: FMN-binding protein                                                                                             SCOP domains
               CATH domains 1wlkB00 B:1-122 Electron Transport, Fmn-binding Protein; Chain A                                                           CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhh...eeeeeee....eeeeeee.hhheee...eeeeee..hhhhhhhhhhh.eeeeeeeeeeee....eeeeeeeeeeeeee.hhhhhhhhh......eeeeeeeeeeeeee Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------- Transcript
                 1wlk B   1 MLPGTFFEVLKNEGVVAIATQGEDGPHLVNTWNSYLKVLDGNRIVVPVGGMHKTEANVARDERVLMTLGSRKVAGRNGPGTGFLIRGSAAFRTDGPEFEAIARFKWARAALVITVVSAEQTE 122
                                    10        20        30        40        50        60        70        80        90       100       110       120  


Chain C from PDB  Type:PROTEIN  Length:122
 aligned with FMNB_DESVM | Q46604 from UniProtKB/Swiss-Prot  Length:122

    Alignment length:122
                                    10        20        30        40        50        60        70        80        90       100       110       120  
           FMNB_DESVM     1 MLPGTFFEVLKNEGVVAIATQGEDGPHLVNTWNSYLKVLDGNRIVVPVGGMHKTEANVARDERVLMTLGSRKVAGRNGPGTGFLIRGSAAFRTDGPEFEAIARFKWARAALVITVVSAEQTL 122
               SCOP domains d1wlkc_ C: FMN-binding protein                                                                                             SCOP domains
               CATH domains 1wlkC00 C:1-122 Electron Transport, Fmn-binding Protein; Chain A                                                           CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhh...eeeeeeee..eeeeeeee.hhheee...eeeeee..hhhhhhhhhhh.eeeeeeeeeeee....eeeeeeeeeeeeee..hhhhhh........eeeeeeeeeeeeee Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------- Transcript
                 1wlk C   1 MLPGTFFEVLKNEGVVAIATQGEDGPHLVNTWNSYLKVLDGNRIVVPVGGMHKTEANVARDERVLMTLGSRKVAGRNGPGTGFLIRGSAAFRTDGPEFEAIARFKWARAALVITVVSAEQTE 122
                                    10        20        30        40        50        60        70        80        90       100       110       120  


Chain D from PDB  Type:PROTEIN  Length:122
 aligned with FMNB_DESVM | Q46604 from UniProtKB/Swiss-Prot  Length:122

    Alignment length:122
                                    10        20        30        40        50        60        70        80        90       100       110       120  
           FMNB_DESVM     1 MLPGTFFEVLKNEGVVAIATQGEDGPHLVNTWNSYLKVLDGNRIVVPVGGMHKTEANVARDERVLMTLGSRKVAGRNGPGTGFLIRGSAAFRTDGPEFEAIARFKWARAALVITVVSAEQTL 122
               SCOP domains d1wlkd_ D: FMN-binding protein                                                                                             SCOP domains
               CATH domains 1wlkD00 D:1-122 Electron Transport, Fmn-binding Protein; Chain A                                                           CATH domains
           Pfam domains (1) -Pyridox_oxidase-1wlkD01 D:2-96                                                                 -------------------------- Pfam domains (1)
           Pfam domains (2) -Pyridox_oxidase-1wlkD02 D:2-96                                                                 -------------------------- Pfam domains (2)
           Pfam domains (3) -Pyridox_oxidase-1wlkD03 D:2-96                                                                 -------------------------- Pfam domains (3)
           Pfam domains (4) -Pyridox_oxidase-1wlkD04 D:2-96                                                                 -------------------------- Pfam domains (4)
         Sec.struct. author ..hhhhhhhhh...eeeeeee....eeeeeee.hhheee...eeeeee..hhhhhhhhhhh.eeeeeeeeeeee....eeeeeeeeeeeeee..hhhhhh........eeeeeeeeeeeeee Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------- Transcript
                 1wlk D   1 MLPGTFFEVLKNEGVVAIATQGEDGPHLVNTWNSYLKVLDGNRIVVPVGGMHKTEANVARDERVLMTLGSRKVAGRNGPGTGFLIRGSAAFRTDGPEFEAIARFKWARAALVITVVSAEQTE 122
                                    10        20        30        40        50        60        70        80        90       100       110       120
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 4)

Asymmetric Unit
(-)
Class: All beta proteins (24004)

(-) CATH Domains  (1, 4)

Asymmetric Unit
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (1, 4)

Asymmetric Unit
(-)
Clan: FMN-binding (25)

(-) Gene Ontology  (6, 6)

Asymmetric Unit(hide GO term definitions)
Chain A,B,C,D   (FMNB_DESVM | Q46604)
molecular function
    GO:0010181    FMN binding    Interacting selectively and non-covalently with flavin mono nucleotide. Flavin mono nucleotide (FMN) is the coenzyme or the prosthetic group of various flavoprotein oxidoreductase enzymes.
    GO:0016491    oxidoreductase activity    Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
    GO:0004733    pyridoxamine-phosphate oxidase activity    Catalysis of the reaction: pyridoxamine 5'-phosphate + H2O + O2 = pyridoxal 5'-phosphate + NH3 + hydrogen peroxide.
biological process
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
    GO:0042823    pyridoxal phosphate biosynthetic process    The chemical reactions and pathways resulting in the formation of pyridoxal phosphate, pyridoxal phosphorylated at the hydroxymethyl group of C-5, the active form of vitamin B6.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    FMN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1wlk)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1wlk
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  FMNB_DESVM | Q46604
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  FMNB_DESVM | Q46604
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        FMNB_DESVM | Q46604: 1axj 1flm 1wli 2e83 3a20 3a6q 3a6r 3amf 3awh 3vy2 3vy5 3vya

(-) Related Entries Specified in the PDB File

1flm
1wli L122Y MUTANT
1wll L122K MUTANT