1WGT - JenaLib

Asym./Biol. Unit - manually (Jmol Viewer)

Asym./Biol. Unit (Jmol Viewer)

Title :   X-RAY STRUCTURE OF WHEAT GERM AGGLUTININ ISOLECTIN 3

Authors :   K. Harata, H. Nagahora, Y. Jigami

Date :   17 Apr 95 (Deposition) - 10 Jul 95 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.90

Chains :   Asym./Biol. Unit : A,B

Keywords :   Lectin (Agglutinin) (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   K. Harata, H. Nagahora, Y. Jigami
X-Ray Structure Of Wheat Germ Agglutinin Isolectin 3.
Acta Crystallogr. , Sect. D V. 51 1013 1995
PubMed-ID: 15299769 | Reference-DOI: 10.1107/S0907444995004070
(for further references see the PDB file header)

Molecule 1 - WHEAT GERM LECTIN
	Chains	:	A, B
	Engineered	:	YES
	Organism Common	:	BREAD WHEAT
	Organism Scientific	:	TRITICUM AESTIVUM
	Organism Taxid	:	4565

		1	2
Asymmetric/Biological Unit	:	A	B

Summary Information (see also Sequences/Alignments below)

Asymmetric/Biological Unit (1, 2)

No.	Name	Count	Type	Full Name
1	PCA	2	Mod. Amino Acid	PYROGLUTAMIC ACID

(no "Site" information available for 1WGT)

Asymmetric/Biological Unit

No.	Residues
1	A:3	-	A:18
2	A:12	-	A:24
3	A:17	-	A:31
4	A:35	-	A:40
5	A:46	-	A:61
6	A:55	-	A:67
7	A:60	-	A:74
8	A:78	-	A:83
9	A:89	-	A:104
10	A:98	-	A:110
11	A:103	-	A:117
12	A:121	-	A:126
13	A:132	-	A:147
14	A:141	-	A:153
15	A:146	-	A:160
16	A:164	-	A:169
17	B:3	-	B:18
18	B:12	-	B:24
19	B:17	-	B:31
20	B:35	-	B:40
21	B:46	-	B:61
22	B:55	-	B:67
23	B:60	-	B:74
24	B:78	-	B:83
25	B:89	-	B:104
26	B:98	-	B:110
27	B:103	-	B:117
28	B:121	-	B:126
29	B:132	-	B:147
30	B:141	-	B:153
31	B:146	-	B:160
32	B:164	-	B:169

(no "Cis Peptide Bond" information available for 1WGT)

(no "SAP(SNP)/Variant" information available for 1WGT)

Asymmetric/Biological Unit (2, 16)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	CHIT_BIND_I_2	PS50941	Chitin-binding type-1 domain profile.	AGI3_WHEAT	1-42 43-85 86-128 129-171	8	A:2-42 B:2-42 A:43-85 B:43-85 A:86-128 B:86-128 A:129-171 B:129-171
2	CHIT_BIND_I_1	PS00026	Chitin recognition or binding domain signature.	AGI3_WHEAT	12-31 55-74 98-117 141-160	8	A:12-31 B:12-31 A:55-74 B:55-74 A:98-117 B:98-117 A:141-160 B:141-160

(no "Exon" information available for 1WGT)

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:171
 aligned with AGI3_WHEAT | P10969 from UniProtKB/Swiss-Prot  Length:186

    Alignment length:171
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170 
           AGI3_WHEAT     1 QRCGEQGSGMECPNNLCCSQYGYCGMGGDYCGKGCQNGACWTSKRCGSQAGGKTCPNNHCCSQYGHCGFGAEYCGAGCQGGPCRADIKCGSQAGGKLCPNNLCCSQWGYCGLGSEFCGEGCQNGACSTDKPCGKDAGGRVCTNNYCCSKWGSCGIGPGYCGAGCQSGGCDG 171
               SCOP domains d1wgta1 A:1-52 Wheat germ agglutinin (WGA)          d1wgta2 A:53-86                   d1wgta3 A:87-129                           d1wgta4 A:130-171                          SCOP domains
               CATH domains -1wgtA01 A:2-42                           1wgtA02 A:43-85                            1wgtA03 A:86-128                           1wgtA04 A:129-171                           CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhh...hhhhhee.....ee.hhhhhh..............hhhhh...hhhhhee.....ee.hhhhhh......................hhhhhee.....ee.hhhhhh...........................ee.....ee.hhhhhh.......... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) CHIT_BIND_I_2  PDB: A:2-42 UniProt: 1-42  CHIT_BIND_I_2  PDB: A:43-85 UniProt: 43-85 CHIT_BIND_I_2  PDB: A:86-128               CHIT_BIND_I_2  PDB: A:129-171               PROSITE (1)
                PROSITE (2) -----------CHIT_BIND_I_1       -----------------------CHIT_BIND_I_1       -----------------------CHIT_BIND_I_1       -----------------------CHIT_BIND_I_1       ----------- PROSITE (2)
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1wgt A   1 xRCGEQGSGMECPNNLCCSQYGYCGMGGDYCGKGCQNGACWTSKRCGSQAGGKTCPNNHCCSQYGHCGFGAEYCGAGCQGGPCRADIKCGSQAGGKLCPNNLCCSQWGYCGLGSEFCGEGCQNGACSTDKPCGKDAGGRVCTNNYCCSKWGSCGIGPGYCGAGCQSGGCDG 171
                            |       10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170 
                            |                                                                                                                                                                          
                            1-PCA

Chain B from PDB  Type:PROTEIN  Length:171
 aligned with AGI3_WHEAT | P10969 from UniProtKB/Swiss-Prot  Length:186

    Alignment length:171
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170 
           AGI3_WHEAT     1 QRCGEQGSGMECPNNLCCSQYGYCGMGGDYCGKGCQNGACWTSKRCGSQAGGKTCPNNHCCSQYGHCGFGAEYCGAGCQGGPCRADIKCGSQAGGKLCPNNLCCSQWGYCGLGSEFCGEGCQNGACSTDKPCGKDAGGRVCTNNYCCSKWGSCGIGPGYCGAGCQSGGCDG 171
               SCOP domains d1wgtb1 B:1-52 Wheat germ agglutinin (WGA)          d1wgtb2 B:53-86                   d1wgtb3 B:87-129                           d1wgtb4 B:130-171                          SCOP domains
               CATH domains -1wgtB01 B:2-42                           1wgtB02 B:43-85                            1wgtB03 B:86-128                           1wgtB04 B:129-171                           CATH domains
           Pfam domains (1) --------------------------------------------------------------------------------------------------------------------------------Chitin_bind_1-1wgtB01 B:129-169          -- Pfam domains (1)
           Pfam domains (2) --------------------------------------------------------------------------------------------------------------------------------Chitin_bind_1-1wgtB02 B:129-169          -- Pfam domains (2)
           Pfam domains (3) --------------------------------------------------------------------------------------------------------------------------------Chitin_bind_1-1wgtB03 B:129-169          -- Pfam domains (3)
           Pfam domains (4) --------------------------------------------------------------------------------------------------------------------------------Chitin_bind_1-1wgtB04 B:129-169          -- Pfam domains (4)
           Pfam domains (5) --------------------------------------------------------------------------------------------------------------------------------Chitin_bind_1-1wgtB05 B:129-169          -- Pfam domains (5)
           Pfam domains (6) --------------------------------------------------------------------------------------------------------------------------------Chitin_bind_1-1wgtB06 B:129-169          -- Pfam domains (6)
           Pfam domains (7) --------------------------------------------------------------------------------------------------------------------------------Chitin_bind_1-1wgtB07 B:129-169          -- Pfam domains (7)
           Pfam domains (8) --------------------------------------------------------------------------------------------------------------------------------Chitin_bind_1-1wgtB08 B:129-169          -- Pfam domains (8)
         Sec.struct. author ..hhhhhh...hhhhhee.....ee.hhhhhh.............hhhhhh...hhhhhee.....ee.hhhhhh..............hhhhh...hhhhhee.....ee.hhhhhh...........................ee.....ee.hhhhhh.......... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) CHIT_BIND_I_2  PDB: B:2-42 UniProt: 1-42  CHIT_BIND_I_2  PDB: B:43-85 UniProt: 43-85 CHIT_BIND_I_2  PDB: B:86-128               CHIT_BIND_I_2  PDB: B:129-171               PROSITE (1)
                PROSITE (2) -----------CHIT_BIND_I_1       -----------------------CHIT_BIND_I_1       -----------------------CHIT_BIND_I_1       -----------------------CHIT_BIND_I_1       ----------- PROSITE (2)
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1wgt B   1 xRCGEQGSGMECPNNLCCSQYGYCGMGGDYCGKGCQNGACWTSKRCGSQAGGKTCPNNHCCSQYGHCGFGAEYCGAGCQGGPCRADIKCGSQAGGKLCPNNLCCSQWGYCGLGSEFCGEGCQNGACSTDKPCGKDAGGRVCTNNYCCSKWGSCGIGPGYCGAGCQSGGCDG 171
                            |       10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170 
                            1-PCA

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric/Biological Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Small proteins (3458)

Fold: Knottins (small inhibitors, toxins, lectins) (761)

Superfamily: Plant lectins/antimicrobial peptides (31)

Family: Hevein-like agglutinin (lectin) domain (28)

Protein domain: Wheat germ agglutinin (WGA) (12)

Wheat (Triticum aestivum), also known as Triticum vulgare [TaxId: 4565] (12)

1a	d1wgta1	A:1-52
1b	d1wgta2	A:53-86
1c	d1wgta3	A:87-129
1d	d1wgta4	A:130-171
1e	d1wgtb1	B:1-52
1f	d1wgtb2	B:53-86
1g	d1wgtb3	B:87-129
1h	d1wgtb4	B:130-171

Asymmetric/Biological Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: 2-Layer Sandwich (8480)

Topology: Wheat Germ Agglutinin (Isolectin 2); domain 1 (140)

Homologous Superfamily: [code=3.30.60.10, no name defined] (23)

Bread wheat (Triticum aestivum) (10)

1a	1wgtA02	A:43-85
1b	1wgtB02	B:43-85
1c	1wgtA03	A:86-128
1d	1wgtB03	B:86-128
1e	1wgtA01	A:2-42
1f	1wgtB01	B:2-42
1g	1wgtA04	A:129-171
1h	1wgtB04	B:129-171

Asymmetric/Biological Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: no clan defined [family: Chitin_bind_1] (17)

Family: Chitin_bind_1 (17)

Triticum aestivum (Wheat) (8)

1a	Chitin_bind_1-1wgtB01	B:129-169
1b	Chitin_bind_1-1wgtB02	B:129-169
1c	Chitin_bind_1-1wgtB03	B:129-169
1d	Chitin_bind_1-1wgtB04	B:129-169
1e	Chitin_bind_1-1wgtB05	B:129-169
1f	Chitin_bind_1-1wgtB06	B:129-169
1g	Chitin_bind_1-1wgtB07	B:129-169
1h	Chitin_bind_1-1wgtB08	B:129-169

Asymmetric/Biological Unit(hide GO term definitions)

Chain A,B (AGI3_WHEAT | P10969)

molecular function
	GO:0030246		carbohydrate binding		Interacting selectively and non-covalently with any carbohydrate, which includes monosaccharides, oligosaccharides and polysaccharides as well as substances derived from monosaccharides by reduction of the carbonyl group (alditols), by oxidation of one or more hydroxy groups to afford the corresponding aldehydes, ketones, or carboxylic acids, or by replacement of one or more hydroxy group(s) by a hydrogen atom. Cyclitols are generally not regarded as carbohydrates.
	GO:0008061		chitin binding		Interacting selectively and non-covalently with chitin, a linear polysaccharide consisting of beta-(1->4)-linked N-acetyl-D-glucosamine residues.

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		PCA	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
(no "Sites" information available for 1wgt)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1wgt)

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1wgt
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	AGI3_WHEAT \| P10969
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	AGI3_WHEAT \| P10969
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	AGI3_WHEAT \| P10969	:	1k7t 1k7u 1k7v 2x52

(no "Related Entries Specified in the PDB File" available for 1WGT)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 2)

Sites (0, 0)

SS Bonds (32, 32)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (2, 16)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 8)

CATH Domains (1, 8)

Pfam Domains (1, 8)

Gene Ontology (2, 2)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File