Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  SOLUTION STRUCTURE OF RNA BINDING DOMAIN IN BAB13405(HOMOLOG EXC-7)
 
Authors :  K. Tsuda, Y. Muto, T. Nagata, S. Suzuki, T. Someya, T. Kigawa, T. Terada, M. Shirouzu, M. Inoue, S. Yokoyama, Riken Structural Genomics/Proteomics Initiative (Rsgi)
Date :  27 May 04  (Deposition) - 27 Nov 04  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (20x)
Keywords :  Rbd, Structural Genomics, Riken Structural Genomics/Proteomics Initiative, Rsgi, Rna Binding Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  K. Tsuda, Y. Muto, T. Nagata, S. Suzuki, T. Someya, T. Kigawa, T. Terada, M. Shirouzu, M. Inoue, S. Yokoyama
Solution Structure Of Rna Binding Domain In Bab13405(Homolog Exc-7)
To Be Published
PubMed: search
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - KIAA1579 PROTEIN
    ChainsA
    EngineeredYES
    Expression System PlasmidP040126-21
    Expression System Vector TypePLASMID
    FragmentRRM DOMAIN
    GeneRIKEN CDNA 04678
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    Other DetailsCELL-FREE PROTEIN SYNTHSESIS
    SynonymHOMOLOG EXC-7

 Structural Features

(-) Chains, Units

  
NMR Structure (20x)

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1WG1)

(-) Sites  (0, 0)

(no "Site" information available for 1WG1)

(-) SS Bonds  (1, 1)

NMR Structure
No.Residues
1A:108 -A:123

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1WG1)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1WG1)

(-) PROSITE Motifs  (1, 2)

NMR Structure (1, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1RRMPS50102 Eukaryotic RNA Recognition Motif (RRM) profile.RAVR2_HUMAN142-220
69-140
231-309
  2A:168-177
A:97-166
-

(-) Exons   (3, 3)

NMR Structure (3, 3)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1ENST000002944281ENSE00002184781chr1:65210778-65211104327RAVR2_HUMAN1-83831A:90-109 (gaps)67
1.2ENST000002944282ENSE00001681312chr1:65234339-6523440567RAVR2_HUMAN84-106231A:110-13223
1.3aENST000002944283aENSE00001671384chr1:65243306-65243775470RAVR2_HUMAN106-2621571A:132-177 (gaps)79
1.4ENST000002944284ENSE00001650476chr1:65247063-65247254192RAVR2_HUMAN263-326640--
1.5ENST000002944285ENSE00001065196chr1:65255071-65255197127RAVR2_HUMAN327-369430--
1.6ENST000002944286ENSE00001065199chr1:65268659-6526874486RAVR2_HUMAN369-397290--
1.7aENST000002944287aENSE00001454278chr1:65270417-65270521105RAVR2_HUMAN398-432350--
1.8ENST000002944288ENSE00001065207chr1:65270674-65270788115RAVR2_HUMAN433-471390--
1.9ENST000002944289ENSE00001065203chr1:65272889-65273157269RAVR2_HUMAN471-560900--
1.10aENST0000029442810aENSE00001685144chr1:65278421-65278532112RAVR2_HUMAN561-598380--
1.11aENST0000029442811aENSE00001179004chr1:65280387-65280523137RAVR2_HUMAN598-643460--
1.12aENST0000029442812aENSE00001065211chr1:65296522-652989122391RAVR2_HUMAN644-691480--

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:88
 aligned with RAVR2_HUMAN | Q9HCJ3 from UniProtKB/Swiss-Prot  Length:691

    Alignment length:168
                                    26        36        46        56        66        76        86        96       106       116       126       136       146       156       166       176        
          RAVR2_HUMAN    17 GSAAGLGPGPGLRGQGPSAEAHEGAPDPMPAALHPEEVAARLQRMQRELSNRRKILVKNLPQDSNCQEVHDLLKDYDLKYCYVDRNKRTAFVTLLNGEQAQNAIQMFHQYSFRGKDLIVQLQPTDALLCITNVPISFTSEEFEELVRAYGNIERCFLVYSEVTGHSKG 184
               SCOP domains d1wg1a_                                                A: Probable RNA-binding protein KIAA1579                                                                          SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------RRM_6-1wg1A01 A:97-159                                         --------------------------------------------------- Pfam domains
         Sec.struct. author .......-----------------------------------------------eeee......hhhhhhhhh.......eeeehhhheeee...hhhhhhhhhhhhh.eee..eeeeeee.........---------------------------------..... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ----------------------------------------------------RRM  PDB: A:97-166 UniProt: 69-140                                      -RRM  PDB: A:168-177 UniProt: 142-220        PROSITE
           Transcript 1 (1) Exon 1.1  PDB: A:90-109 (gaps) UniProt: 1-83 [INCOMPLETE]          Exon 1.2  PDB: A:110-13------------------------------------------------------------------------------ Transcript 1 (1)
           Transcript 1 (2) -----------------------------------------------------------------------------------------Exon 1.3a  PDB: A:132-177 (gaps) UniProt: 106-262 [INCOMPLETE]                  Transcript 1 (2)
                 1wg1 A  90 GSSGSSG-----------------------------------------------ILVKNLPQDSNCQEVHDLLKDYDLKYCYVDRNKRTAFVTLLNGEQAQNAIQMFHQYSFRGKDLIVQLQPTDALLCS---------------------------------GPSSG 177
                                  |  -         -         -         -         -    |  102       112       122       132       142       152       162       172         -         -         -   |    
                                 96                                              97                                                                        172                               173    

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 1WG1)

(-) Pfam Domains  (1, 1)

NMR Structure
(-)
Clan: RRM (206)

(-) Gene Ontology  (6, 6)

NMR Structure(hide GO term definitions)
Chain A   (RAVR2_HUMAN | Q9HCJ3)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0003676    nucleic acid binding    Interacting selectively and non-covalently with any nucleic acid.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
biological process
    GO:0000398    mRNA splicing, via spliceosome    The joining together of exons from one or more primary transcripts of messenger RNA (mRNA) and the excision of intron sequences, via a spliceosomal mechanism, so that mRNA consisting only of the joined exons is produced.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1wg1)
 
  Sites
(no "Sites" information available for 1wg1)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1wg1)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1wg1
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  RAVR2_HUMAN | Q9HCJ3
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  RAVR2_HUMAN | Q9HCJ3
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1WG1)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1WG1)