Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF CYTOCHROME C2 MUTANT G95E
 
Authors :  C. Dumortier, J. Fitch, F. Van Petegem, W. Vermeulen, T. E. Meyer, J. J. Van Beeumen, M. A. Cusanovich
Date :  27 Apr 04  (Deposition) - 17 Jun 04  (Release) - 20 Jun 12  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.30
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Keywords :  Electron Transport, Redox (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  C. Dumortier, J. Fitch, F. Van Petegem, W. Vermeulen, T. E. Meyer, J. J. Van Beeumen, M. A. Cusanovich
Protein Dynamics In The Region Of The Sixth Ligand Methionine Revealed By Studies Of Imidazole Binding To Rhodobacter Capsulatus Cytochrome C2 Hinge Mutants.
Biochemistry V. 43 7717 2004
PubMed-ID: 15196014  |  Reference-DOI: 10.1021/BI0362370

(-) Compounds

Molecule 1 - CYTOCHROME C2
    ChainsA, B
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    MutationYES
    Organism ScientificRHODOBACTER CAPSULATUS
    Organism Taxid1061

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit AB
Biological Unit 1 (1x)A 
Biological Unit 2 (1x) B

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 2)

Asymmetric Unit (1, 2)
No.NameCountTypeFull Name
1HEM2Ligand/IonPROTOPORPHYRIN IX CONTAINING FE
Biological Unit 1 (1, 1)
No.NameCountTypeFull Name
1HEM1Ligand/IonPROTOPORPHYRIN IX CONTAINING FE
Biological Unit 2 (1, 1)
No.NameCountTypeFull Name
1HEM1Ligand/IonPROTOPORPHYRIN IX CONTAINING FE

(-) Sites  (2, 2)

Asymmetric Unit (2, 2)
No.NameEvidenceResiduesDescription
1AC1SOFTWARELYS A:12 , CYS A:13 , CYS A:16 , HIS A:17 , LEU A:37 , ARG A:43 , ALA A:45 , GLY A:46 , TYR A:53 , LYS A:54 , ILE A:57 , TRP A:67 , TYR A:75 , VAL A:76 , GLU A:95 , MET A:96 , PHE A:98 , HOH A:2017 , HOH A:2028 , HOH A:2038 , HOH A:2039BINDING SITE FOR RESIDUE HEM A1117
2AC2SOFTWARECYS B:13 , CYS B:16 , HIS B:17 , ARG B:43 , ALA B:45 , GLY B:46 , TYR B:53 , LYS B:54 , ILE B:57 , TRP B:67 , TYR B:75 , VAL B:76 , THR B:94 , GLU B:95 , MET B:96 , PHE B:98 , HOH B:2043BINDING SITE FOR RESIDUE HEM B1117

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1VYD)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1VYD)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (2, 4)

Asymmetric Unit (2, 4)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_CYC2_RHOCB_001 *L108TCYC2_RHOCB  ---  ---A/BL87T
2UniProtVAR_CYC2_RHOCB_002 *T115SCYC2_RHOCB  ---  ---A/BT94S
   * ID not provided by source

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 1 (2, 2)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_CYC2_RHOCB_001 *L108TCYC2_RHOCB  ---  ---AL87T
2UniProtVAR_CYC2_RHOCB_002 *T115SCYC2_RHOCB  ---  ---AT94S
   * ID not provided by source

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 2 (2, 2)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_CYC2_RHOCB_001 *L108TCYC2_RHOCB  ---  ---BL87T
2UniProtVAR_CYC2_RHOCB_002 *T115SCYC2_RHOCB  ---  ---BT94S
   * ID not provided by source

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (1, 2)

Asymmetric Unit (1, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1CYTCPS51007 Cytochrome c family profile.CYC2_RHOCB22-136
 
  2A:1-115
B:1-115
Biological Unit 1 (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1CYTCPS51007 Cytochrome c family profile.CYC2_RHOCB22-136
 
  1A:1-115
-
Biological Unit 2 (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1CYTCPS51007 Cytochrome c family profile.CYC2_RHOCB22-136
 
  1-
B:1-115

(-) Exons   (0, 0)

(no "Exon" information available for 1VYD)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:116
 aligned with CYC2_RHOCB | P00094 from UniProtKB/Swiss-Prot  Length:137

    Alignment length:116
                                    31        41        51        61        71        81        91       101       111       121       131      
           CYC2_RHOCB    22 GDAAKGEKEFNKCKTCHSIIAPDGTEIVKGAKTGPNLYGVVGRTAGTYPEFKYKDSIVALGASGFAWTEEDIATYVKDPGAFLKEKLDDKKAKTGMAFKLAKGGEDVAAYLASVVK 137
               SCOP domains d1vyda_ A: Cytochrome c2                                                                                             SCOP domains
               CATH domains 1vydA00 A:1-116 Cytochrome c                                                                                         CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhh.....ee.....eee.........................hhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhh..............hhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------T------S---------------------- SAPs(SNPs)
                    PROSITE CYTC  PDB: A:1-115 UniProt: 22-136                                                                                 - PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------- Transcript
                 1vyd A   1 GDAAKGEKEFNKCKTCHSIIAPDGTEIVKGAKTGPNLYGVVGRTAGTYPEFKYKDSIVALGASGFAWTEEDIATYVKDPGAFLKEKLDDKKAKTEMAFKLAKGGEDVAAYLASVVK 116
                                    10        20        30        40        50        60        70        80        90       100       110      

Chain B from PDB  Type:PROTEIN  Length:116
 aligned with CYC2_RHOCB | P00094 from UniProtKB/Swiss-Prot  Length:137

    Alignment length:116
                                    31        41        51        61        71        81        91       101       111       121       131      
           CYC2_RHOCB    22 GDAAKGEKEFNKCKTCHSIIAPDGTEIVKGAKTGPNLYGVVGRTAGTYPEFKYKDSIVALGASGFAWTEEDIATYVKDPGAFLKEKLDDKKAKTGMAFKLAKGGEDVAAYLASVVK 137
               SCOP domains d1vydb_ B: Cytochrome c2                                                                                             SCOP domains
               CATH domains 1vydB00 B:1-116 Cytochrome c                                                                                         CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhh....ee.....eee.........................hhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhh..............hhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------T------S---------------------- SAPs(SNPs)
                    PROSITE CYTC  PDB: B:1-115 UniProt: 22-136                                                                                 - PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------- Transcript
                 1vyd B   1 GDAAKGEKEFNKCKTCHSIIAPDGTEIVKGAKTGPNLYGVVGRTAGTYPEFKYKDSIVALGASGFAWTEEDIATYVKDPGAFLKEKLDDKKAKTEMAFKLAKGGEDVAAYLASVVK 116
                                    10        20        30        40        50        60        70        80        90       100       110      

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric Unit

(-) CATH Domains  (1, 2)

Asymmetric Unit

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1VYD)

(-) Gene Ontology  (5, 5)

Asymmetric Unit(hide GO term definitions)
Chain A,B   (CYC2_RHOCB | P00094)
molecular function
    GO:0009055    electron carrier activity    Any molecular entity that serves as an electron acceptor and electron donor in an electron transport chain. An electron transport chain is a process in which a series of electron carriers operate together to transfer electrons from donors to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
    GO:0020037    heme binding    Interacting selectively and non-covalently with heme, any compound of iron complexed in a porphyrin (tetrapyrrole) ring.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
biological process
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
    GO:0015979    photosynthesis    The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    HEM  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1vyd)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1vyd
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  CYC2_RHOCB | P00094
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  CYC2_RHOCB | P00094
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        CYC2_RHOCB | P000941c2n 1c2r

(-) Related Entries Specified in the PDB File

1c2n CYTOCHROME C2, NMR, 20 STRUCTURES
1c2r CYTOCHROME C2