|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric Unit (1, 2)
|
Asymmetric Unit (2, 2)
|
(no "SS Bond" information available for 1C2R) |
(no "Cis Peptide Bond" information available for 1C2R) |
Asymmetric Unit (2, 4)
|
Asymmetric Unit (1, 2)
|
(no "Exon" information available for 1C2R) |
Asymmetric UnitChain A from PDB Type:PROTEIN Length:116 aligned with CYC2_RHOCB | P00094 from UniProtKB/Swiss-Prot Length:137 Alignment length:116 31 41 51 61 71 81 91 101 111 121 131 CYC2_RHOCB 22 GDAAKGEKEFNKCKTCHSIIAPDGTEIVKGAKTGPNLYGVVGRTAGTYPEFKYKDSIVALGASGFAWTEEDIATYVKDPGAFLKEKLDDKKAKTGMAFKLAKGGEDVAAYLASVVK 137 SCOP domains d1c2ra_ A: Cytochrome c2 SCOP domains CATH domains 1c2rA00 A:1-116 Cytochrome c CATH domains Pfam domains -------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------T------S---------------------- SAPs(SNPs) PROSITE CYTC PDB: A:1-115 UniProt: 22-136 - PROSITE Transcript -------------------------------------------------------------------------------------------------------------------- Transcript 1c2r A 1 GDAAKGEKEFNKCKTCHSIIAPDGTEIVKGAKTGPNLYGVVGRTAGTYPEFKYKDSIVALGASGFAWTEEDIATYVKDPGAFLKEKLDDKKAKTGMAFKLAKGGEDVAAYLASVVK 116 10 20 30 40 50 60 70 80 90 100 110 Chain B from PDB Type:PROTEIN Length:116 aligned with CYC2_RHOCB | P00094 from UniProtKB/Swiss-Prot Length:137 Alignment length:116 31 41 51 61 71 81 91 101 111 121 131 CYC2_RHOCB 22 GDAAKGEKEFNKCKTCHSIIAPDGTEIVKGAKTGPNLYGVVGRTAGTYPEFKYKDSIVALGASGFAWTEEDIATYVKDPGAFLKEKLDDKKAKTGMAFKLAKGGEDVAAYLASVVK 137 SCOP domains d1c2rb_ B: Cytochrome c2 SCOP domains CATH domains 1c2rB00 B:1-116 Cytochrome c CATH domains Pfam domains -------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------T------S---------------------- SAPs(SNPs) PROSITE CYTC PDB: B:1-115 UniProt: 22-136 - PROSITE Transcript -------------------------------------------------------------------------------------------------------------------- Transcript 1c2r B 1 GDAAKGEKEFNKCKTCHSIIAPDGTEIVKGAKTGPNLYGVVGRTAGTYPEFKYKDSIVALGASGFAWTEEDIATYVKDPGAFLKEKLDDKKAKTGMAFKLAKGGEDVAAYLASVVK 116 10 20 30 40 50 60 70 80 90 100 110
|
Asymmetric Unit
|
Asymmetric Unit |
(no "Pfam Domain" information available for 1C2R) |
Asymmetric Unit(hide GO term definitions) Chain A,B (CYC2_RHOCB | P00094)
|
|
|
|
|
|
|