Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  MOLECULAR STRUCTURE OF CYTOCHROME C2 ISOLATED FROM RHODOBACTER CAPSULATUS DETERMINED AT 2.5 ANGSTROMS RESOLUTION
 
Authors :  M. M. Benning, G. Wesenberg, M. S. Caffrey, R. G. Bartsch, T. E. Meyer, M. A. Cusanovich, I. Rayment, H. M. Holden
Date :  19 Mar 91  (Deposition) - 15 Jan 92  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.50
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Keywords :  Electron Transport Protein (Cytochrome) (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  M. M. Benning, G. Wesenberg, M. S. Caffrey, R. G. Bartsch, T. E. Meyer, M. A. Cusanovich, I. Rayment, H. M. Holden
Molecular Structure Of Cytochrome C2 Isolated From Rhodobacter Capsulatus Determined At 2. 5 A Resolution.
J. Mol. Biol. V. 220 673 1991
PubMed-ID: 1651396  |  Reference-DOI: 10.1016/0022-2836(91)90109-J
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - CYTOCHROME C2
    ChainsA, B
    EngineeredYES
    Organism ScientificRHODOBACTER CAPSULATUS
    Organism Taxid1061

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit AB
Biological Unit 1 (1x)A 
Biological Unit 2 (1x) B

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 2)

Asymmetric Unit (1, 2)
No.NameCountTypeFull Name
1HEM2Ligand/IonPROTOPORPHYRIN IX CONTAINING FE
Biological Unit 1 (1, 1)
No.NameCountTypeFull Name
1HEM1Ligand/IonPROTOPORPHYRIN IX CONTAINING FE
Biological Unit 2 (1, 1)
No.NameCountTypeFull Name
1HEM1Ligand/IonPROTOPORPHYRIN IX CONTAINING FE

(-) Sites  (2, 2)

Asymmetric Unit (2, 2)
No.NameEvidenceResiduesDescription
1AC1SOFTWARELYS A:12 , CYS A:13 , CYS A:16 , HIS A:17 , PRO A:35 , ARG A:43 , GLY A:46 , TYR A:53 , LYS A:54 , ILE A:57 , TRP A:67 , TYR A:75 , VAL A:76 , GLY A:95 , MET A:96 , VAL A:107 , HOH A:131 , HOH A:136 , HOH A:150BINDING SITE FOR RESIDUE HEM A 120
2AC2SOFTWARELYS B:12 , CYS B:13 , CYS B:16 , HIS B:17 , ARG B:43 , GLY B:46 , TYR B:53 , LYS B:54 , ILE B:57 , TRP B:67 , TYR B:75 , VAL B:76 , GLY B:95 , MET B:96 , PHE B:98 , HOH B:134 , HOH B:156 , HOH B:163BINDING SITE FOR RESIDUE HEM B 120

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1C2R)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1C2R)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (2, 4)

Asymmetric Unit (2, 4)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_CYC2_RHOCB_001 *L108TCYC2_RHOCB  ---  ---A/BL87T
2UniProtVAR_CYC2_RHOCB_002 *T115SCYC2_RHOCB  ---  ---A/BT94S
   * ID not provided by source

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 1 (2, 2)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_CYC2_RHOCB_001 *L108TCYC2_RHOCB  ---  ---AL87T
2UniProtVAR_CYC2_RHOCB_002 *T115SCYC2_RHOCB  ---  ---AT94S
   * ID not provided by source

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 2 (2, 2)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_CYC2_RHOCB_001 *L108TCYC2_RHOCB  ---  ---BL87T
2UniProtVAR_CYC2_RHOCB_002 *T115SCYC2_RHOCB  ---  ---BT94S
   * ID not provided by source

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (1, 2)

Asymmetric Unit (1, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1CYTCPS51007 Cytochrome c family profile.CYC2_RHOCB22-136
 
  2A:1-115
B:1-115
Biological Unit 1 (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1CYTCPS51007 Cytochrome c family profile.CYC2_RHOCB22-136
 
  1A:1-115
-
Biological Unit 2 (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1CYTCPS51007 Cytochrome c family profile.CYC2_RHOCB22-136
 
  1-
B:1-115

(-) Exons   (0, 0)

(no "Exon" information available for 1C2R)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:116
 aligned with CYC2_RHOCB | P00094 from UniProtKB/Swiss-Prot  Length:137

    Alignment length:116
                                    31        41        51        61        71        81        91       101       111       121       131      
           CYC2_RHOCB    22 GDAAKGEKEFNKCKTCHSIIAPDGTEIVKGAKTGPNLYGVVGRTAGTYPEFKYKDSIVALGASGFAWTEEDIATYVKDPGAFLKEKLDDKKAKTGMAFKLAKGGEDVAAYLASVVK 137
               SCOP domains d1c2ra_ A: Cytochrome c2                                                                                             SCOP domains
               CATH domains 1c2rA00 A:1-116 Cytochrome c                                                                                         CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhh..ee.....eee..........................hhhhhhhhh.....hhhhhhhhh..hhhhhhhh................hhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------T------S---------------------- SAPs(SNPs)
                    PROSITE CYTC  PDB: A:1-115 UniProt: 22-136                                                                                 - PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------- Transcript
                 1c2r A   1 GDAAKGEKEFNKCKTCHSIIAPDGTEIVKGAKTGPNLYGVVGRTAGTYPEFKYKDSIVALGASGFAWTEEDIATYVKDPGAFLKEKLDDKKAKTGMAFKLAKGGEDVAAYLASVVK 116
                                    10        20        30        40        50        60        70        80        90       100       110      

Chain B from PDB  Type:PROTEIN  Length:116
 aligned with CYC2_RHOCB | P00094 from UniProtKB/Swiss-Prot  Length:137

    Alignment length:116
                                    31        41        51        61        71        81        91       101       111       121       131      
           CYC2_RHOCB    22 GDAAKGEKEFNKCKTCHSIIAPDGTEIVKGAKTGPNLYGVVGRTAGTYPEFKYKDSIVALGASGFAWTEEDIATYVKDPGAFLKEKLDDKKAKTGMAFKLAKGGEDVAAYLASVVK 137
               SCOP domains d1c2rb_ B: Cytochrome c2                                                                                             SCOP domains
               CATH domains 1c2rB00 B:1-116 Cytochrome c                                                                                         CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhh..ee.....eee..........................hhhhhhhhh.....hhhhhhhhh..hhhhhhhh................hhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------T------S---------------------- SAPs(SNPs)
                    PROSITE CYTC  PDB: B:1-115 UniProt: 22-136                                                                                 - PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------- Transcript
                 1c2r B   1 GDAAKGEKEFNKCKTCHSIIAPDGTEIVKGAKTGPNLYGVVGRTAGTYPEFKYKDSIVALGASGFAWTEEDIATYVKDPGAFLKEKLDDKKAKTGMAFKLAKGGEDVAAYLASVVK 116
                                    10        20        30        40        50        60        70        80        90       100       110      

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric Unit

(-) CATH Domains  (1, 2)

Asymmetric Unit

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1C2R)

(-) Gene Ontology  (5, 5)

Asymmetric Unit(hide GO term definitions)
Chain A,B   (CYC2_RHOCB | P00094)
molecular function
    GO:0009055    electron carrier activity    Any molecular entity that serves as an electron acceptor and electron donor in an electron transport chain. An electron transport chain is a process in which a series of electron carriers operate together to transfer electrons from donors to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
    GO:0020037    heme binding    Interacting selectively and non-covalently with heme, any compound of iron complexed in a porphyrin (tetrapyrrole) ring.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
biological process
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
    GO:0015979    photosynthesis    The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    HEM  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1c2r)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1c2r
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  CYC2_RHOCB | P00094
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  CYC2_RHOCB | P00094
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        CYC2_RHOCB | P000941c2n 1vyd

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1C2R)