|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (4, 12)| Asymmetric/Biological Unit (4, 12) |
Sites (3, 3)
Asymmetric Unit (3, 3)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1VR3) |
Cis Peptide Bonds (2, 2)
Asymmetric/Biological Unit
|
||||||||||||
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1VR3) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1VR3) |
Exons (0, 0)| (no "Exon" information available for 1VR3) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:179 aligned with MTND_MOUSE | Q99JT9 from UniProtKB/Swiss-Prot Length:179 Alignment length:179 10 20 30 40 50 60 70 80 90 100 110 120 130 140 150 160 170 MTND_MOUSE 1 MVQAWYMDESTADPRKPHRAQPDRPVSLEQLRTLGVLYWKLDADKYENDPELEKIRKMRNYSWMDIITICKDTLPNYEEKIKMFFEEHLHLDEEIRYILEGSGYFDVRDKEDKWIRISMEKGDMITLPAGIYHRFTLDEKNYVKAMRLFVGEPVWTPYNRPADHFDARVQYMSFLEGTA 179 SCOP domains d1vr3a1 A:1-179 Acireductone dioxygenase SCOP domains CATH domains -1vr3A00 A:2-179 Jelly Rolls CATH domains Pfam domains --ARD-1vr3A01 A:3-157 ---------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1vr3 A 1 mVQAWYmDESTADPRKPHRAQPDRPVSLEQLRTLGVLYWKLDADKYENDPELEKIRKmRNYSWmDIITICKDTLPNYEEKIKmFFEEHLHLDEEIRYILEGSGYFDVRDKEDKWIRISmEKGDmITLPAGIYHRFTLDEKNYVKAmRLFVGEPVWTPYNRPADHFDARVQYmSFLEGTA 179 | | 10 20 30 40 50 |60 | 70 80 | 90 100 110 120 | 130 140 | 150 160 170 | | 7-MSE 58-MSE | 83-MSE 119-MSE| 146-MSE 172-MSE 1-MSE 64-MSE 124-MSE
|
||||||||||||||||||||
SCOP Domains (1, 1)
Asymmetric/Biological Unit
|
CATH Domains (1, 1)
Asymmetric/Biological Unit
|
Pfam Domains (1, 1)| Asymmetric/Biological Unit |
Gene Ontology (14, 14)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A (MTND_MOUSE | Q99JT9)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|